Synaptotagmin-like protein 4 (SYTL4) Recombinant Protein | SYTL4 recombinant protein
Recombinant Human Synaptotagmin-like protein 4 (SYTL4)
Gene Names
SYTL4; SLP4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Synaptotagmin-like protein 4 (SYTL4); Recombinant Human Synaptotagmin-like protein 4 (SYTL4); SYTL4 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-671, Full length protein
Sequence
MSELLDLSFLSEEEKDLILSVLQRDEEVRKADEKRIRRLKNELLEIKRKGAKRGSQHYSDRTCARCQESLGRLSPKTNTCRGCNHLVCRDCRIQESNGTWRCKVCAKEIELKKATGDWFYDQKVNRFAYRTGSEIIRMSLRHKPAVSKRETVGQSLLHQTQMGDIWPGRKIIQERQKEPSVLFEVPKLKSGKSALEAESESLDSFTADSDSTSRRDSLDKSGLFPEWKKMSAPKSQVEKETQPGGQNVVFVDEGEMIFKKNTRKILRPSEYTKSVIDLRPEDVVHESGSLGDRSKSVPGLNVDMEEEEEEEDIDHLVKLHRQKLARSSMQSGSSMSTIGSMMSIYSEAGDFGNIFVTGRIAFSLKYEQQTQSLVVHVKECHQLAYADEAKKRSNPYVKTYLLPDKSRQGKRKTSIKRDTINPLYDETLRYEIPESLLAQRTLQFSVWHHGRFGRNTFLGEAEIQMDSWKLDKKLDHCLPLHGKISAESPTGLPSHKGELVVSLKYIPASKTPVGGDRKKSKGGEGGELQVWIKEAKNLTAAKAGGTSDSFVKGYLLPMRNKASKRKTPVMKKTLNPHYNHTFVYNGVRLEDLQHMCLELTVWDREPLASNDFLGGVRLGVGTGISNGEVVDWMDSTGEEVSLWQKMRQYPGSWAEGTLQLRSSMAKQKLGL
Sequence Length
671
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
39,813 Da
NCBI Official Full Name
synaptotagmin-like protein 4
NCBI Official Synonym Full Names
synaptotagmin like 4
NCBI Official Symbol
SYTL4
NCBI Official Synonym Symbols
SLP4
NCBI Protein Information
synaptotagmin-like protein 4
UniProt Protein Name
Synaptotagmin-like protein 4
Protein Family
UniProt Gene Name
SYTL4
NCBI Description
This gene encodes a member of the synaptotagmin like protein family. Members of this family are characterized by an N-terminal Rab27 binding domain and C-terminal tandem C2 domains. The encoded protein binds specific small Rab GTPases and is involved in intracellular membrane trafficking. This protein binds Rab27 and may be involved in inhibiting dense core vesicle exocytosis. Alternate splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Mar 2010]
Uniprot Description
Modulates exocytosis of dense-core granules and secretion of hormones in the pancreas and the pituitary. Interacts with vesicles containing negatively charged phospholipids in a Ca2+-independent manner ().
Research Articles on SYTL4
Similar Products
Product Notes
The SYTL4 sytl4 (Catalog #AAA1465025) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-671, Full length protein. The amino acid sequence is listed below: MSELLDLSFL SEEEKDLILS VLQRDEEVRK ADEKRIRRLK NELLEIKRKG AKRGSQHYSD RTCARCQESL GRLSPKTNTC RGCNHLVCRD CRIQESNGTW RCKVCAKEIE LKKATGDWFY DQKVNRFAYR TGSEIIRMSL RHKPAVSKRE TVGQSLLHQT QMGDIWPGRK IIQERQKEPS VLFEVPKLKS GKSALEAESE SLDSFTADSD STSRRDSLDK SGLFPEWKKM SAPKSQVEKE TQPGGQNVVF VDEGEMIFKK NTRKILRPSE YTKSVIDLRP EDVVHESGSL GDRSKSVPGL NVDMEEEEEE EDIDHLVKLH RQKLARSSMQ SGSSMSTIGS MMSIYSEAGD FGNIFVTGRI AFSLKYEQQT QSLVVHVKEC HQLAYADEAK KRSNPYVKTY LLPDKSRQGK RKTSIKRDTI NPLYDETLRY EIPESLLAQR TLQFSVWHHG RFGRNTFLGE AEIQMDSWKL DKKLDHCLPL HGKISAESPT GLPSHKGELV VSLKYIPASK TPVGGDRKKS KGGEGGELQV WIKEAKNLTA AKAGGTSDSF VKGYLLPMRN KASKRKTPVM KKTLNPHYNH TFVYNGVRLE DLQHMCLELT VWDREPLASN DFLGGVRLGV GTGISNGEVV DWMDSTGEEV SLWQKMRQYP GSWAEGTLQL RSSMAKQKLG L. It is sometimes possible for the material contained within the vial of "Synaptotagmin-like protein 4 (SYTL4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
