Protein syd (syd) Recombinant Protein | syd recombinant protein
Recombinant Salmonella typhi Protein syd (syd)
Gene Names
STY3106; syd
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein syd (syd); Recombinant Salmonella typhi Protein syd (syd); syd recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-181, Full length protein
Sequence
MDELTAQALKAFTTRYCDAWQEKHGSWPLSEELYGVPSPCIISSTRDAVYWQPQPFEGEENVNAVERAFDIMVQPALHAFYTTQFAGDMPAQFADEKLTLLQTWSQDDFRRVQENLIGHLVTQKRLKLPPTLFIATQENELEVISVCNLSGEVIKETLGTRNRTVLAATLAEFLTQLNPLL
Sequence Length
181
Species
Salmonella typhi
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
20,518 Da
NCBI Official Full Name
SecY interacting protein Syd
NCBI Official Symbol
STY3106
NCBI Official Synonym Symbols
syd
NCBI Protein Information
SecY interacting protein Syd
UniProt Protein Name
Protein Syd
Protein Family
UniProt Gene Name
syd
Uniprot Description
Interacts with the SecY protein in vivo. May bind preferentially to an uncomplexed state of SecY, thus functioning either as a chelating agent for excess SecY in the cell or as a regulatory factor that negatively controls the translocase function.
Similar Products
Product Notes
The syd syd (Catalog #AAA1231422) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-181, Full length protein. The amino acid sequence is listed below: MDELTAQALK AFTTRYCDAW QEKHGSWPLS EELYGVPSPC IISSTRDAVY WQPQPFEGEE NVNAVERAFD IMVQPALHAF YTTQFAGDMP AQFADEKLTL LQTWSQDDFR RVQENLIGHL VTQKRLKLPP TLFIATQENE LEVISVCNLS GEVIKETLGT RNRTVLAATL AEFLTQLNPL L. It is sometimes possible for the material contained within the vial of "Protein syd (syd), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
