Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit swp1 (swp1) Recombinant Protein | swp1 recombinant protein
Recombinant Dictyostelium discoideum Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit swp1 (swp1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit swp1 (swp1); Recombinant Dictyostelium discoideum Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit swp1 (swp1); swp1 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
19-685aa; full length protein
Sequence
GSVQSKITTTRGISNVYSKNDINNIKQFISSKYNGNTKLYGESLKDTFYGVGVLTRIGET NIEATKDICKQTKEQLKQNKFTDIELVFNGVTILSELKCLQGESSSSLGNEQQLQDLLKN KLENGSLLEKTQAINIYFTLSSAKAIDSKTVSIIDPLLIQAVNSMVSLMDEDGTFKSVST DDEGNLQNTAAAYFALARLSHRLKSNEVDKLVAKVVNKVDTVLASADETTDSLYFNDLST TSSLLHGLLSLASVNDKVADVISNKQINQISEYLLRQKNVESLSDAYHLIVALKRCQKNS ISQPISLALVKSIYSPSGLNDIRVRVTDIFDQPIEASIVINKVVSSKNPRSTPILSGKEM KFQSSDNSFVADLSNENLKLGSYNFEFKVQPVDTDSYKSITNIQIITITGAVTVNDMKLS YAPKSDQLGSPKTTNEVQFGQKLPLIEIPSNNIARIFFRIASEAQPYQAQQVGIRFYSPA REAVVPATYSADAYSYTFTNKDACKILGCQSGNYQLDLIIGDQSITPLQWNFGEINLKFN QSTIPTNRYPEQLPISHNFRVAEKRPPQSISSLFTLLVLSPIAIFVIGLLFVGTNLGRFP TGMGFIYTIGFLGCISATGLLIVNYWLHSTMDVTLKNLALLMIPLVFFGHKSMSYYSNLS SSNIKKD
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Dictyostelium discoideum (Slime mold)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for swp1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
75,616 Da
NCBI Official Full Name
dolichyl-diphosphooligosaccharide-protein glycotransferase
NCBI Official Symbol
swp1
NCBI Protein Information
dolichyl-diphosphooligosaccharide-protein glycotransferase; oligosaccharyltransferase delta subunit
UniProt Protein Name
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit swp1
UniProt Gene Name
swp1
UniProt Synonym Gene Names
rpn2; Oligosaccharyl transferase subunit swp1; RPN-II
UniProt Entry Name
RPN2_DICDI
Uniprot Description
Essential subunit of the N-oligosaccharyl transferase (OST) complex which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains.
Similar Products
Product Notes
The swp1 swp1 (Catalog #AAA7030725) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 19-685aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the swp1 swp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GSVQSKITTT RGISNVYSKN DINNIKQFIS SKYNGNTKLY GESLKDTFYG VGVLTRIGET NIEATKDICK QTKEQLKQNK FTDIELVFNG VTILSELKCL QGESSSSLGN EQQLQDLLKN KLENGSLLEK TQAINIYFTL SSAKAIDSKT VSIIDPLLIQ AVNSMVSLMD EDGTFKSVST DDEGNLQNTA AAYFALARLS HRLKSNEVDK LVAKVVNKVD TVLASADETT DSLYFNDLST TSSLLHGLLS LASVNDKVAD VISNKQINQI SEYLLRQKNV ESLSDAYHLI VALKRCQKNS ISQPISLALV KSIYSPSGLN DIRVRVTDIF DQPIEASIVI NKVVSSKNPR STPILSGKEM KFQSSDNSFV ADLSNENLKL GSYNFEFKVQ PVDTDSYKSI TNIQIITITG AVTVNDMKLS YAPKSDQLGS PKTTNEVQFG QKLPLIEIPS NNIARIFFRI ASEAQPYQAQ QVGIRFYSPA REAVVPATYS ADAYSYTFTN KDACKILGCQ SGNYQLDLII GDQSITPLQW NFGEINLKFN QSTIPTNRYP EQLPISHNFR VAEKRPPQSI SSLFTLLVLS PIAIFVIGLL FVGTNLGRFP TGMGFIYTIG FLGCISATGL LIVNYWLHST MDVTLKNLAL LMIPLVFFGH KSMSYYSNLS SSNIKKD. It is sometimes possible for the material contained within the vial of "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit swp1 (swp1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
