Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Zinc metalloproteinase-disintegrin ammodytagin Recombinant Protein | SVMP recombinant protein

Recombinant Vipera ammodytes ammodytes Zinc metalloproteinase-disintegrin ammodytagin

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Zinc metalloproteinase-disintegrin ammodytagin; Recombinant Vipera ammodytes ammodytes Zinc metalloproteinase-disintegrin ammodytagin; Recombinant Zinc metalloproteinase-disintegrin ammodytagin; Zinc metalloproteinase-disintegrin ammodytagin EC= 3.4.24.-; Ammodytagin; SVMP recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-183aa; full length protein
Sequence
KSAAXVTLDLFGDWRAKRHDNAQLLTGINLNGQTLGIAFMSKXSVGLIQDYXKSYLLVAS VMAELGHNLGMEHDDGNXIXPAKXIDNKPLRTDIVSPAVXGNYFVELTPGSQCADGVCCD QCRKAGVTVAPDLXFDYNQLGTEDKFTHSPDDPDYGMVDLGTKCADGKVCNSNRQXVDVN TAY
Sequence Length
184
Species
Vipera ammodytes ammodytes (Western sand viper)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

UniProt Accession #
Molecular Weight
19,879 Da
UniProt Protein Name
Zinc metalloproteinase-disintegrin ammodytagin
UniProt Gene Name
SVMP
UniProt Synonym Gene Names
SVMP
UniProt Entry Name
VM3A_VIPAA

Uniprot Description

Function: Snake venom zinc metalloprotease that has fibrinogenolytic and hemorrhagic activities in mouse and rats. Hydrolyzes the Aalpha-chain (FGA) and more slowly the Bbeta-chain of fibrinogen (FGB), without affecting the gamma-chain. Its hemorrhagic activity results of its involvement in cleavage of basal membrane components (nidogen and fibronectin but not laminin) and depletion of fibrinogen, prothrombin (F2) and factor X (F10) in blood circulation. Also possess potent azocaseinolytic activity and cleaves insulin B-chain, hydrolyzing it at positions Gln(4)-His5, His(10)-Leu(11) and Tyr(16)-Leu(17). Ref.1

Cofactor: Binds 1 calcium ion

By similarity.Binds 1 zinc ion

By similarity.

Enzyme regulation: Inhibited by EDTA, DTT and zinc ions. Partially inhibited by L-cysteine. Not inhibited by 2-propanol or PMSF. Activity is enhanced by calcium or magnesium ions. Ref.1

Subunit structure: Heterodimer; disulfide-linked. Ref.1

Subcellular location: Secreted.

Tissue specificity: Expressed by the venom gland. Ref.1

Post-translational modification: The N-terminus is blocked.N-glycosylated. Ref.1

Miscellaneous: The hemorrhagic activity of the whole venom is completely neutralized by an antiserum against this metalloproteinase (Ref.1).

Sequence similarities: Belongs to the venom metalloproteinase family. P-III subfamily.Contains 1 disintegrin domain.Contains 1 peptidase M12B domain.

Mass spectrometry: Molecular mass is 108000 Da . Determined by MALDI. Monomer. Ref.1

Similar Products

Product Notes

The Zinc metalloproteinase-disintegrin ammodytagin svmp (Catalog #AAA1193426) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-183aa; full length protein. The amino acid sequence is listed below: KSAAXVTLDL FGDWRAKRHD NAQLLTGINL NGQTLGIAFM SKXSVGLIQD YXKSYLLVAS VMAELGHNLG MEHDDGNXIX PAKXIDNKPL RTDIVSPAVX GNYFVELTPG SQCADGVCCD QCRKAGVTVA PDLXFDYNQL GTEDKFTHSP DDPDYGMVDL GTKCADGKVC NSNRQXVDVN TAY. It is sometimes possible for the material contained within the vial of "Zinc metalloproteinase-disintegrin ammodytagin, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.