Small ubiquitin-related modifier 1 (Sumo1) Recombinant Protein | Sumo1 recombinant protein

Recombinant Mouse Small ubiquitin-related modifier 1 (Sumo1)

Cat. Num. AAA949909

• Gene Names: Sumo1; GMP1; PIC1; SMT3; Ubl1; SMTP3; Smt3C; SMT3H3; SUMO-1; SENTRIN
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Small ubiquitin-related modifier 1 (Sumo1); Recombinant Mouse Small ubiquitin-related modifier 1 (Sumo1); Sumo1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-97, Full length protein
• Sequence: SDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
• Sequence Length: 96

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Sumo1 recombinant protein

This gene encodes a protein that is a member of the SUMO (small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last four amino acids of the carboxy-terminus have been cleaved off. Several pseudogenes have been reported for this gene. Alternate transcriptional splice variants encoding different isoforms have been characterized.

NCBI and Uniprot Product Information

• NCBI GI #: 6678489
• NCBI GeneID: 22218
• NCBI Accession #: NP_033486.1
• NCBI GenBank Nucleotide #: NM_009460.2
• UniProt Accession #: P63166; P55856; Q3TX92; Q93068
• Molecular Weight: 11,557 Da
• NCBI Official Full Name: small ubiquitin-related modifier 1
• NCBI Official Synonym Full Names: small ubiquitin-like modifier 1
• NCBI Official Symbol: Sumo1
• NCBI Official Synonym Symbols: GMP1; PIC1; SMT3; Ubl1; SMTP3; Smt3C; SMT3H3; SUMO-1; SENTRIN
• NCBI Protein Information: small ubiquitin-related modifier 1
• UniProt Protein Name: Small ubiquitin-related modifier 1
• Protein Family: Small ubiquitin-related modifier
• UniProt Gene Name: Sumo1
• UniProt Synonym Gene Names: Smt3c; Smt3h3; Ubl1; SUMO-1; Smt3C

Uniprot Description

Ubiquitin-like protein that can be covalently attached to proteins as a monomer or a lysine-linked polymer. Covalent attachment via an isopeptide bond to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by E3 ligases such as PIAS1-4, RANBP2 or CBX4. This post-translational modification on lysine residues of proteins plays a crucial role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Involved for instance in targeting RANGAP1 to the nuclear pore complex protein RANBP2. Covalently attached to the voltage-gated potassium channel KCNB1; this modulates the gating characteristics of KCNB1. Polymeric SUMO1 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins. May also regulate a network of genes involved in palate development. Covalently attached to ZFHX3 ().