Sulfotransferase family cytosolic 1B member 1 (SULT1B1) Recombinant Protein | SULT1B1 recombinant protein
Recombinant Dog Sulfotransferase family cytosolic 1B member 1 (SULT1B1)
Gene Names
SULT1B1; ST1B1; ST1B2; cSULT1B1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Sulfotransferase family cytosolic 1B member 1 (SULT1B1); Recombinant Dog Sulfotransferase family cytosolic 1B member 1 (SULT1B1); SULT1B1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-296, Full length protein
Sequence
MISPKDFLRKNLKMIHGYPIIYTFANNWENIEQFHSRPDDIIIATYPKSGTTWVSEIVDMVLNNGDVEKCKRDFITVKVPMLEMAVPGLRTSGIEQLEKNPSPRLVKTHLPIALLPKSFWENNCKMIYLARNAKDVAVSYYHFDLMNNLEPAPGPWEEYLERFMTGNVAYGSWFNHVKSWWKKKEEHPILFLYYEDMKENPKREVQKIARFLEKNLNDEVLDKIIHHTSFEMMKDNPLVNYTHLPSTVMDHSKSSFMRKGIAGDWKNYFTVAQNEKFDVIYKKEMSGTTLQFRTEI
Sequence Length
296
Species
Canis familiaris (Dog) (Canis lupus familiaris)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for SULT1B1 recombinant protein
Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. However, the total genomic length of this gene is greater than that of other SULT1 genes.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34,869 Da
NCBI Official Full Name
sulfotransferase family cytosolic 1B member 1
NCBI Official Synonym Full Names
sulfotransferase family 1B member 1
NCBI Official Symbol
SULT1B1
NCBI Official Synonym Symbols
ST1B1; ST1B2; cSULT1B1
NCBI Protein Information
sulfotransferase family cytosolic 1B member 1
UniProt Protein Name
Sulfotransferase family cytosolic 1B member 1
Protein Family
UniProt Gene Name
SULT1B1
UniProt Synonym Gene Names
ST1B2; ST1B1; Sulfotransferase 1B1; cSULT1B1
Uniprot Description
Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs and xenobiotic compounds. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. Sulfates thyroid hormones including 3,3'-diiodothyronine, 3,5,3'-triidothyronine and 3,5'-diiodothyronine (lesser degree) and phenols such as 1-naphthol and p-nitrophenol.
Similar Products
Product Notes
The SULT1B1 sult1b1 (Catalog #AAA1331852) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-296, Full length protein. The amino acid sequence is listed below: MISPKDFLRK NLKMIHGYPI IYTFANNWEN IEQFHSRPDD IIIATYPKSG TTWVSEIVDM VLNNGDVEKC KRDFITVKVP MLEMAVPGLR TSGIEQLEKN PSPRLVKTHL PIALLPKSFW ENNCKMIYLA RNAKDVAVSY YHFDLMNNLE PAPGPWEEYL ERFMTGNVAY GSWFNHVKSW WKKKEEHPIL FLYYEDMKEN PKREVQKIAR FLEKNLNDEV LDKIIHHTSF EMMKDNPLVN YTHLPSTVMD HSKSSFMRKG IAGDWKNYFT VAQNEKFDVI YKKEMSGTTL QFRTEI. It is sometimes possible for the material contained within the vial of "Sulfotransferase family cytosolic 1B member 1 (SULT1B1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
