Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Quaternary ammonium compound-resistance protein sugE (sugE) Recombinant Protein | sugE recombinant protein

Recombinant Escherichia coli Quaternary ammonium compound-resistance protein sugE (sugE)

Gene Names
sugE; ECK4144; JW5738
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Quaternary ammonium compound-resistance protein sugE (sugE); Recombinant Escherichia coli Quaternary ammonium compound-resistance protein sugE (sugE); sugE recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-105
Sequence
MSWIILVIAGLLEVVWAVGLKYTHGFSRLTPSVITVTAMIVSMALLAWAMKSLPVGTAYAVWTGIGAVGAAITGIVLLGESANPMRLASLALIVLGIIGLKLSTH
Sequence Length
105
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Related Product Information for sugE recombinant protein
sugE

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10,900 Da
NCBI Official Full Name
multidrug efflux system protein
NCBI Official Symbol
sugE
NCBI Official Synonym Symbols
ECK4144; JW5738
NCBI Protein Information
multidrug efflux system protein
UniProt Protein Name
Quaternary ammonium compound-resistance protein SugE
UniProt Gene Name
sugE
UniProt Entry Name
SUGE_ECOLI

NCBI Description

SugE belongs to the SMR efflux pump family, DMT superfamily. [More information is available at EcoGene: EG11616]. SugE is a member of the SMR family of proton-dependent drug efflux transporters . [More information is available at EcoCyc: EG11616].

Uniprot Description

Function: Quaternary ammonium compound efflux pump. Confers resistance to cetylpyridinium, cetyldimethylethyl ammonium and cetrimide cations. Ref.6

Subcellular location: Cell inner membrane; Multi-pass membrane protein Ref.7.

Miscellaneous: Unlike the other members of the SMR family, SugE exhibits a narrow specificity for a very specific class of compounds.

Sequence similarities: Belongs to the small multidrug resistance (SMR) protein family. SugE (TC 2.A.7.1.4) subfamily. [View classification]

Caution: Was originally (Ref.1) thought to suppress a groEL mutation and mimic the effect of groE overexpression. This was later shown (Ref.6) to be probably due to an artifact.

Sequence caution: The sequence AAA97047.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.The sequence CAA49570.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Research Articles on sugE

Similar Products

Product Notes

The sugE suge (Catalog #AAA1087397) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-105. The amino acid sequence is listed below: MSWIILVIAG LLEVVWAVGL KYTHGFSRLT PSVITVTAMI VSMALLAWAM KSLPVGTAYA VWTGIGAVGA AITGIVLLGE SANPMRLASL ALIVLGIIGL KLSTH. It is sometimes possible for the material contained within the vial of "Quaternary ammonium compound-resistance protein sugE (sugE), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.