Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

HERV-K_1q23.3 provirus ancestral Env polyprotein Recombinant Protein | SU recombinant protein

Recombinant Human HERV-K_1q23.3 provirus ancestral Env polyprotein

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
HERV-K_1q23.3 provirus ancestral Env polyprotein; Recombinant Human HERV-K_1q23.3 provirus ancestral Env polyprotein; Recombinant HERV-K_1q23.3 provirus ancestral Env polyprotein; Envelope polyprotein HERV-K(C1a) envelope protein HERV-K110 envelope protein HERV-K18 envelope protein HERV-K18 superantigen IDDMK1; 2 22 envelo; SU recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
355-560
Sequence
FIFTLIAVIMGLIAVTATAAVAGVALHSSVQSVNFVNYWQKNSTRLWNSQSSIDQKLASQINDLRQTVIWMGDRLMTLEHHFQLQCDWNTSDFCITPQIYNESEHHWDMVRRHLQGREDNLTLDISKLKEQIFEASKAHLNLVPGTEAIAGVADGLANLNPVTWIKTIRSTMIINLILIVVCLFCLLLVCRCTQQLRRDSDIENGP
Sequence Length
560
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
63,671 Da
NCBI Official Full Name
HERV-K_1q23.3 provirus ancestral Env polyprotein
UniProt Protein Name
HERV-K_1q23.3 provirus ancestral Env polyprotein
UniProt Gene Name
SU
UniProt Synonym Gene Names
TM
UniProt Entry Name
ENK7_HUMAN

Uniprot Description

ENK7: Retroviral envelope proteins mediate receptor recognition and membrane fusion during early infection. Endogenous envelope proteins may have kept, lost or modified their original function during evolution. This envelope protein has superantigenic properties. Belongs to the beta type-B retroviral envelope protein family. HERV class-II K(HML-2) env subfamily.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q23.3

Similar Products

Product Notes

The HERV-K_1q23.3 provirus ancestral Env polyprotein su (Catalog #AAA1138661) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 355-560. The amino acid sequence is listed below: FIFTLIAVIM GLIAVTATAA VAGVALHSSV QSVNFVNYWQ KNSTRLWNSQ SSIDQKLASQ INDLRQTVIW MGDRLMTLEH HFQLQCDWNT SDFCITPQIY NESEHHWDMV RRHLQGREDN LTLDISKLKE QIFEASKAHL NLVPGTEAIA GVADGLANLN PVTWIKTIRS TMIINLILIV VCLFCLLLVC RCTQQLRRDS DIENGP. It is sometimes possible for the material contained within the vial of "HERV-K_1q23.3 provirus ancestral Env polyprotein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.