Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Tyrosine-protein kinase STYK1 (STYK1) Recombinant Protein | STYK1 recombinant protein

Recombinant Human Tyrosine-protein kinase STYK1 (STYK1)

Gene Names
STYK1; NOK; SuRTK106
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tyrosine-protein kinase STYK1 (STYK1); Recombinant Human Tyrosine-protein kinase STYK1 (STYK1); STYK1 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-422aa; full length protein
Sequence
MGMTRMLLECSLSDKLCVIQEKQYEVIIVPTLLVTIFLILLGVILWLFIREQRTQQQRSG PQGIAPVPPPRDLSWEAGHGGNVALPLKETSVENFLGATTPALAKLQVPREQLSEVLEQI CSGSCGPIFRANMNTGDPSKPKSVILKALKEPAGLHEVQDFLGRIQFHQYLGKHKNLVQL EGCCTEKLPLYMVLEDVAQGDLLSFLWTCRRDVMTMDGLLYDLTEKQVYHIGKQVLLALE FLQEKHLFHGDVAARNILMQSDLTAKLCGLGLAYEVYTRGAISSTQTIPLKWLAPERLLL RPASIRADVWSFGILLYEMVTLGAPPYPEVPPTSILEHLQRRKIMKRPSSCTHTMYSIMK SCWRWREADRPSPRELRLRLEAAIKTADDEAVLQVPELVVPELYAAVAGIRVESLFYNYS ML
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for STYK1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47,577 Da
NCBI Official Full Name
tyrosine-protein kinase STYK1
NCBI Official Synonym Full Names
serine/threonine/tyrosine kinase 1
NCBI Official Symbol
STYK1
NCBI Official Synonym Symbols
NOK; SuRTK106
NCBI Protein Information
tyrosine-protein kinase STYK1
UniProt Protein Name
Tyrosine-protein kinase STYK1
Protein Family
UniProt Gene Name
STYK1
UniProt Synonym Gene Names
NOK
UniProt Entry Name
STYK1_HUMAN

NCBI Description

Receptor protein tyrosine kinases, like STYK1, play important roles in diverse cellular and developmental processes, such as cell proliferation, differentiation, and survival (Liu et al., 2004 [PubMed 15150103]).[supplied by OMIM, Mar 2008]

Uniprot Description

STYK1: Probable tyrosine protein-kinase, which has strong transforming capabilities on a variety of cell lines. When overexpressed, it can also induce tumor cell invasion as well as metastasis in distant organs. May act by activating both MAP kinase and phosphatidylinositol 3'-kinases (PI3K) pathways. Belongs to the protein kinase superfamily. Tyr protein kinase family.

Protein type: Protein kinase, tyrosine (receptor); Protein kinase, TK; EC 2.7.10.2; Oncoprotein; Kinase, protein; Membrane protein, integral; TK group; TK-Unique family

Chromosomal Location of Human Ortholog: 12p13.2

Cellular Component: extrinsic to internal side of plasma membrane; integral to membrane; plasma membrane

Molecular Function: ATP binding; non-membrane spanning protein tyrosine kinase activity; protein binding; receptor binding

Biological Process: cell differentiation; cell migration; innate immune response; regulation of cell proliferation; transmembrane receptor protein tyrosine kinase signaling pathway

Research Articles on STYK1

Similar Products

Product Notes

The STYK1 styk1 (Catalog #AAA7030612) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-422aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the STYK1 styk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGMTRMLLEC SLSDKLCVIQ EKQYEVIIVP TLLVTIFLIL LGVILWLFIR EQRTQQQRSG PQGIAPVPPP RDLSWEAGHG GNVALPLKET SVENFLGATT PALAKLQVPR EQLSEVLEQI CSGSCGPIFR ANMNTGDPSK PKSVILKALK EPAGLHEVQD FLGRIQFHQY LGKHKNLVQL EGCCTEKLPL YMVLEDVAQG DLLSFLWTCR RDVMTMDGLL YDLTEKQVYH IGKQVLLALE FLQEKHLFHG DVAARNILMQ SDLTAKLCGL GLAYEVYTRG AISSTQTIPL KWLAPERLLL RPASIRADVW SFGILLYEMV TLGAPPYPEV PPTSILEHLQ RRKIMKRPSS CTHTMYSIMK SCWRWREADR PSPRELRLRL EAAIKTADDE AVLQVPELVV PELYAAVAGI RVESLFYNYS ML. It is sometimes possible for the material contained within the vial of "Tyrosine-protein kinase STYK1 (STYK1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.