Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: AGGF1Sample Tissue: Human OVCAR-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human AGGF1 Polyclonal Antibody | anti-AGGF1 antibody

AGGF1 Antibody - middle region

Gene Names
AGGF1; VG5Q; GPATC7; GPATCH7; HSU84971; HUS84971
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
AGGF1; Polyclonal Antibody; AGGF1 Antibody - middle region; anti-AGGF1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QPYPTSSTKQSKDKKLKKKRKDPDSSATNEEKDLNSEDQKAFSVEHTSCN
Sequence Length
714
Applicable Applications for anti-AGGF1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human AGGF1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: AGGF1Sample Tissue: Human OVCAR-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: AGGF1Sample Tissue: Human OVCAR-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-AGGF1 antibody
This gene encodes an angiogenic factor that promotes proliferation of endothelial cells. Mutations in this gene are associated with a susceptibility to Klippel-Trenaunay syndrome. Pseudogenes of this gene are found on chromosomes 3, 4, 10 and 16.
Product Categories/Family for anti-AGGF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
81 kDa
NCBI Official Full Name
angiogenic factor with G patch and FHA domains 1
NCBI Official Synonym Full Names
angiogenic factor with G-patch and FHA domains 1
NCBI Official Symbol
AGGF1
NCBI Official Synonym Symbols
VG5Q; GPATC7; GPATCH7; HSU84971; HUS84971
NCBI Protein Information
angiogenic factor with G patch and FHA domains 1
UniProt Protein Name
Angiogenic factor with G patch and FHA domains 1
UniProt Gene Name
AGGF1
UniProt Synonym Gene Names
GPATC7; GPATCH7; VG5Q; hVG5Q

NCBI Description

This gene encodes an angiogenic factor that promotes proliferation of endothelial cells. Mutations in this gene are associated with a susceptibility to Klippel-Trenaunay syndrome. Pseudogenes of this gene are found on chromosomes 3, 4, 10 and 16.[provided by RefSeq, Sep 2010]

Uniprot Description

AGGF1: Promotes angiogenesis and the proliferation of endothelial cells. Able to bind to endothelial cells and promote cell proliferation, suggesting that it may act in an autocrine fashion. Defects in AGGF1 are a cause of Klippel-Trenaunay syndrome (KTS). KTS is a congenital disease characterized by malformations of capillary (98% of KTS patients), venous (72%) and lymphatic (11%) vessels, and bony and soft tissue hypertrophy that leads to large cutaneous hemangiomata with hypertrophy of the related bones and soft tissues. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell adhesion; RNA processing

Chromosomal Location of Human Ortholog: 5q13.3

Cellular Component: cytoplasm; extracellular region; perinuclear region of cytoplasm

Molecular Function: nucleic acid binding; protein binding

Biological Process: angiogenesis; cell adhesion; positive regulation of angiogenesis; positive regulation of endothelial cell proliferation; vasculogenesis

Disease: Klippel-trenaunay-weber Syndrome

Research Articles on AGGF1

Similar Products

Product Notes

The AGGF1 aggf1 (Catalog #AAA3222611) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AGGF1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AGGF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AGGF1 aggf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QPYPTSSTKQ SKDKKLKKKR KDPDSSATNE EKDLNSEDQK AFSVEHTSCN. It is sometimes possible for the material contained within the vial of "AGGF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.