Receptor for retinol uptake STRA6 (STRA6) Recombinant Protein | STRA6 recombinant protein
Recombinant Human Receptor for retinol uptake STRA6 (STRA6), partial
Gene Names
STRA6; MCOPS9; MCOPCB8; PP14296
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Receptor for retinol uptake STRA6 (STRA6); Recombinant Human Receptor for retinol uptake STRA6 (STRA6); partial; Retinol-binding protein receptor STRA6; Stimulated by retinoic acid gene 6 protein homolog; STRA6 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-50aa, Partial
Sequence
MSSQPAGNQTSPGATEDYSYGSWYIDEPQGGEELQPEGEVPSCHTSIPPG
Species
Homo sapiens (Human)
Relevance
Functions as retinol transporter. Accepts all-trans retinol from the extracellular retinol-binding protein RBP4, facilitates retinol transport across the cell membrane, and then transfers retinol to the cytoplasmic retinol-binding protein RBP1 (PubMed:9452451, PubMed:18316031, PubMed:22665496). Retinol uptake is enhanced by LRAT, an enzyme that converts retinol to all-trans retinyl esters, the storage forms of vitamin A (PubMed:18316031, PubMed:22665496). Contributes to the activation of a signaling cascade that depends on retinol transport and LRAT-dependent generation of retinol metabolites that then trigger activation of JAK2 and its target STAT5, and ultimately increase the expression of SOCS3 and inhibit cellular responses to insulin (PubMed:21368206, PubMed:22665496). Important for the homeostasis of vitamin A and its derivatives, such as retinoic acid (PubMed:18316031). STRA6-mediated transport is particularly important in the eye, and under conditions of dietary vitamin A deficiency (Probable). Does not transport retinoic acid (PubMed:18316031).
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Product Categories/Family for STRA6 recombinant protein
References
"Cross talk between signaling and vitamin A transport by the retinol-binding protein receptor STRA6."Berry D.C., O'Byrne S.M., Vreeland A.C., Blaner W.S., Noy N.Mol. Cell. Biol. 32:3164-3175(2012)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
75,192 Da
NCBI Official Full Name
stimulated by retinoic acid gene 6 protein homolog isoform a
NCBI Official Synonym Full Names
stimulated by retinoic acid 6
NCBI Official Symbol
STRA6
NCBI Official Synonym Symbols
MCOPS9; MCOPCB8; PP14296
NCBI Protein Information
stimulated by retinoic acid gene 6 protein homolog; retinol binding protein 4 receptor; stimulated by retinoic acid 6 homolog; stimulated by retinoic acid gene 6 homolog
UniProt Protein Name
Stimulated by retinoic acid gene 6 protein homolog
Protein Family
UniProt Gene Name
STRA6
UniProt Entry Name
STRA6_HUMAN
Similar Products
Product Notes
The STRA6 stra6 (Catalog #AAA9018647) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-50aa, Partial. The amino acid sequence is listed below: MSSQPAGNQT SPGATEDYSY GSWYIDEPQG GEELQPEGEV PSCHTSIPPG. It is sometimes possible for the material contained within the vial of "Receptor for retinol uptake STRA6 (STRA6), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
