Metalloreductase STEAP4 (Steap4) Recombinant Protein | Steap4 recombinant protein
Recombinant Mouse Metalloreductase STEAP4 (Steap4)
Gene Names
Steap4; Tiarp; Tnfaip9; AI481214; 1110021O17Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Metalloreductase STEAP4 (Steap4); Recombinant Mouse Metalloreductase STEAP4 (Steap4); Steap4 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-470aa; full length protein
Sequence
MEKAHADEFPLTTDSSEKQGVVCIFGTGDFGKSLGLKMLQCGYSIVFGSRNPQVSSLLPR GAEVLSYSEAASKSDIIILAMHREHYDSLTELVDYLKGKVLVDVSNNRKINQYPESNAEY LAQLEPGAHVVKAFNTISAWALQSGTLDASRQVFVCGNDSKAKQRVMDIARTLGLTPLDQ GSLMAASEIENYPLQLFPMWRFPFYLSSVLCVFFFVYCAIREVIYPYVNGKTDATYRLAI SIPNRVFPITALILLALVYLPGILAAILQLYRGTKYRRFPNWLDHWMLCRKQLGLVALGF AFLHVIYTLVIPIRYYVRWRLRNATITQALTNKDSPFITSYAWINDSYLALGILGFFLFL LLGITSLPSVSNMVNWREFRFVQSKLGYLTLVLCTAHTLVYGGKRFLSPSILRWSLPSAY ILALVIPCAVLVLKCILIMPCIDKTLTRIRQGWERNSKYTQSALNGKSDI
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Steap4 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
52,994 Da
NCBI Official Full Name
metalloreductase STEAP4
NCBI Official Synonym Full Names
STEAP family member 4
NCBI Official Symbol
Steap4
NCBI Official Synonym Symbols
Tiarp; Tnfaip9; AI481214; 1110021O17Rik
NCBI Protein Information
metalloreductase STEAP4
UniProt Protein Name
Metalloreductase STEAP4
Protein Family
UniProt Gene Name
Steap4
UniProt Synonym Gene Names
Tiarp
UniProt Entry Name
STEA4_MOUSE
Uniprot Description
STEAP4: Metalloreductase that has the ability to reduce both Fe(3+) to Fe(2+) and Cu(2+) to Cu(1+). Uses NAD(+) as acceptor. Plays a role in systemic metabolic homeostasis, integrating inflammatory and metabolic responses. Associated with obesity and insulin-resistance. Involved in inflammatory arthritis, through the regulation of inflammatory cytokines. Inhibits anchorage-independent cell proliferation. Belongs to the STEAP family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Oxidoreductase; Membrane protein, multi-pass; Membrane protein, integral; EC 1.16.1.-
Cellular Component: endosome; Golgi apparatus; integral to membrane; integral to plasma membrane; membrane; plasma membrane
Molecular Function: cupric reductase activity; metal ion binding; oxidoreductase activity
Biological Process: copper ion import; ion transport; iron ion homeostasis; transport
Research Articles on Steap4
Similar Products
Product Notes
The Steap4 steap4 (Catalog #AAA7030594) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-470aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Steap4 steap4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEKAHADEFP LTTDSSEKQG VVCIFGTGDF GKSLGLKMLQ CGYSIVFGSR NPQVSSLLPR GAEVLSYSEA ASKSDIIILA MHREHYDSLT ELVDYLKGKV LVDVSNNRKI NQYPESNAEY LAQLEPGAHV VKAFNTISAW ALQSGTLDAS RQVFVCGNDS KAKQRVMDIA RTLGLTPLDQ GSLMAASEIE NYPLQLFPMW RFPFYLSSVL CVFFFVYCAI REVIYPYVNG KTDATYRLAI SIPNRVFPIT ALILLALVYL PGILAAILQL YRGTKYRRFP NWLDHWMLCR KQLGLVALGF AFLHVIYTLV IPIRYYVRWR LRNATITQAL TNKDSPFITS YAWINDSYLA LGILGFFLFL LLGITSLPSV SNMVNWREFR FVQSKLGYLT LVLCTAHTLV YGGKRFLSPS ILRWSLPSAY ILALVIPCAV LVLKCILIMP CIDKTLTRIR QGWERNSKYT QSALNGKSDI. It is sometimes possible for the material contained within the vial of "Metalloreductase STEAP4 (Steap4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
