Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Metalloreductase STEAP3 (Steap3) Recombinant Protein | Steap3 recombinant protein

Recombinant Mouse Metalloreductase STEAP3 (Steap3)

Gene Names
Steap3; Tsap6; pHyde; 1010001D01Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Metalloreductase STEAP3 (Steap3); Recombinant Mouse Metalloreductase STEAP3 (Steap3); Steap3 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-488aa; full length protein
Sequence
MSGEMDKPLISRRLVDSDGSLAEVPKEAPKVGILGSGDFARSLATRLVGSGFSVVVGSRN PKRTAGLFPSLAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLADQLAGKILVDVSNPTEK EHLQHRQSNAEYLASLFPACTVVKAFNVISAWALQAGPRDGNRQVLICSDQPEAKRTISE MARAMGFTPLDMGSLASAREVEAIPLRLLPSWKVPTLLALGLFVCFYTYNFIRDVLQPYI RKDENKFYKMPLSVVNTTLPCVAYVLLSLVYLPGVLAAALQLRRGTKYQRFPDWLDHWLQ HRKQIGLLSFFFAMLHALYSFCLPLRRSHRYDLVNLAVKQVLANKSRLWVEEEVWRMEIY LSLGVLALGMLSLLAVTSLPSIANSLNWKEFSFVQSTLGFVALILSTMHTLTYGWTRAFE ENHYKFYLPPTFTLTLLLPCVIILAKGLFLLPCLSRRLTKIRRGWEKDGAVKFMLPGDHT QGEKTSHV
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Steap3 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58,530 Da
NCBI Official Full Name
metalloreductase STEAP3
NCBI Official Synonym Full Names
STEAP family member 3
NCBI Official Symbol
Steap3
NCBI Official Synonym Symbols
Tsap6; pHyde; 1010001D01Rik
NCBI Protein Information
metalloreductase STEAP3
UniProt Protein Name
Metalloreductase STEAP3
Protein Family
UniProt Gene Name
Steap3
UniProt Synonym Gene Names
Tsap6
UniProt Entry Name
STEA3_MOUSE

Uniprot Description

STEAP3: a multi-pass membrane protein induced directly by p53. Plays an important role in facilitating exosome secretion. Enhances secretion in the DNA damage-induced p53-dependent exosomal secretory pathway. Localizes to vesicular-like structures at the plasma membrane and around the nucleus. Highly expressed in hematopoietic tissues where it localizes to the specialized endosome. An endosomal ferrireductase required for efficient transferrin-dependent iron uptake in erythroid cells. Participates in erythroid iron homeostasis by reducing Fe(3+) to Fe(2+). Can also reduce of Cu(2+) to Cu(1+), suggesting that it participates in copper homeostasis. Uses NAD(+) as acceptor. Contains a highly-conserved tyrosine-based motif that has been shown to target transmembrane proteins, including LAMP-1, LAMP-2, the TfR, and SLC11A1 to endosomes, lysosomes, and lysosome-related organelles. Facilitates the exosomal secretion of proteins such as TCTP. Interacts with BNIP3L, MYT1 and TPT1. Four human isoforms are produced by alternative splicing. Isoform 4 is also known as pHyde II.

Protein type: Membrane protein, integral; Transporter, ion channel; EC 1.16.1.-; Oxidoreductase; Transporter; Transporter, iron; Membrane protein, multi-pass

Cellular Component: endosome; integral to membrane; integral to plasma membrane; membrane; multivesicular body; plasma membrane

Molecular Function: cupric reductase activity; ferric-chelate reductase activity; metal ion binding; oxidoreductase activity

Biological Process: apoptosis; cell cycle; copper ion import; ion transport; iron ion homeostasis; iron ion transport; positive regulation of apoptosis; protein secretion; transport

Research Articles on Steap3

Similar Products

Product Notes

The Steap3 steap3 (Catalog #AAA7030591) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-488aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Steap3 steap3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSGEMDKPLI SRRLVDSDGS LAEVPKEAPK VGILGSGDFA RSLATRLVGS GFSVVVGSRN PKRTAGLFPS LAQVTFQEEA VSSPEVIFVA VFREHYSSLC SLADQLAGKI LVDVSNPTEK EHLQHRQSNA EYLASLFPAC TVVKAFNVIS AWALQAGPRD GNRQVLICSD QPEAKRTISE MARAMGFTPL DMGSLASARE VEAIPLRLLP SWKVPTLLAL GLFVCFYTYN FIRDVLQPYI RKDENKFYKM PLSVVNTTLP CVAYVLLSLV YLPGVLAAAL QLRRGTKYQR FPDWLDHWLQ HRKQIGLLSF FFAMLHALYS FCLPLRRSHR YDLVNLAVKQ VLANKSRLWV EEEVWRMEIY LSLGVLALGM LSLLAVTSLP SIANSLNWKE FSFVQSTLGF VALILSTMHT LTYGWTRAFE ENHYKFYLPP TFTLTLLLPC VIILAKGLFL LPCLSRRLTK IRRGWEKDGA VKFMLPGDHT QGEKTSHV. It is sometimes possible for the material contained within the vial of "Metalloreductase STEAP3 (Steap3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.