Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Protein SSX4 (SSX4) Recombinant Protein | SSX4 recombinant protein

Recombinant Human Protein SSX4 (SSX4)

Gene Names
SSX4B; CT5.4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein SSX4 (SSX4); Recombinant Human Protein SSX4 (SSX4); Protein SSX4; Cancer/testis antigen 5.4; CT5.4; SSX4 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-188aa; Full Length
Sequence
MNGDDAFARRPRDDAQISEKLRKAFDDIAKYFSKKEWEKMKSSEKIVYVYMKLNYEVMTKLGFKVTLPPFMRSKRAADFHGNDFGNDRNHRNQVERPQMTFGSLQRIFPKIMPKKPAEEENGLKEVPEASGPQNDGKQLCPPGNPSTLEKINKTSGPKRGKHAWTHRLRERKQLVVYEEISDPEEDDE
Sequence Length
188
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Related Product Information for SSX4 recombinant protein
Could act as a modulator of transcription.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48.9 kDa
NCBI Official Full Name
protein SSX4 isoform a
NCBI Official Synonym Full Names
synovial sarcoma, X breakpoint 4B
NCBI Official Symbol
SSX4B
NCBI Official Synonym Symbols
CT5.4
NCBI Protein Information
protein SSX4; OTTHUMT00000056510; cancer/testis antigen 5.4
UniProt Protein Name
Protein SSX4
Protein Family
UniProt Gene Name
SSX4
UniProt Synonym Gene Names
SSX4A; CT5.4
UniProt Entry Name
SSX4_HUMAN

NCBI Description

The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X;18) translocation characteristically found in all synovial sarcomas. This translocation results in the fusion of the synovial sarcoma translocation gene on chromosome 18 to one of the SSX genes on chromosome X. Chromosome Xp11 contains a segmental duplication resulting in two identical copies of synovial sarcoma, X breakpoint 4, SSX4 and SSX4B, in tail-to-tail orientation. This gene, SSX4B, represents the more centromeric copy. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

SSX4: Could act as a modulator of transcription. Belongs to the SSX family.

Protein type: Cancer Testis Antigen (CTA)

Chromosomal Location of Human Ortholog: Xp11.23

Cellular Component: nucleus

Molecular Function: nucleic acid binding

Biological Process: regulation of transcription, DNA-dependent; transcription, DNA-dependent

Similar Products

Product Notes

The SSX4 ssx4 (Catalog #AAA1056242) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-188aa; Full Length. The amino acid sequence is listed below: MNGDDAFARR PRDDAQISEK LRKAFDDIAK YFSKKEWEKM KSSEKIVYVY MKLNYEVMTK LGFKVTLPPF MRSKRAADFH GNDFGNDRNH RNQVERPQMT FGSLQRIFPK IMPKKPAEEE NGLKEVPEAS GPQNDGKQLC PPGNPSTLEK INKTSGPKRG KHAWTHRLRE RKQLVVYEEI SDPEEDDE. It is sometimes possible for the material contained within the vial of "Protein SSX4 (SSX4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.