Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Sorcin (SRI) Recombinant Protein | SRI recombinant protein

Recombinant Human Sorcin (SRI)

Gene Names
SRI; SCN; V19; CP22; CP-22
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Sorcin (SRI); Recombinant Human Sorcin (SRI); Sorcin; 22 kDa protein; CP-22; CP22; V19; SRI recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-198. Full Length
Sequence
MAYPGHPGAGGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMSV
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Related Product Information for SRI recombinant protein
Calcium-binding protein that modulates excitation-contraction coupling in the heart. Contributes to calcium homeostasis in the heart sarcoplasmic reticulum. Modulates the activity of RYR2 calcium channels.
Product Categories/Family for SRI recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48.7 kDa
NCBI Official Full Name
sorcin isoform C
NCBI Official Synonym Full Names
sorcin
NCBI Official Symbol
SRI
NCBI Official Synonym Symbols
SCN; V19; CP22; CP-22
NCBI Protein Information
sorcin; H_RG167B05.1; 22 kDa protein; calcium binding protein amplified in mutlidrug-resistant cells
UniProt Protein Name
Sorcin
UniProt Gene Name
SRI
UniProt Synonym Gene Names
CP22
UniProt Entry Name
SORCN_HUMAN

NCBI Description

This gene encodes a calcium-binding protein with multiple E-F hand domains that relocates from the cytoplasm to the sarcoplasmic reticulum in response to elevated calcium levels. In addition to regulating intracellular calcium homeostasis it also modulates excitation-contraction coupling in the heart. Alternative splicing results in multiple transcript variants encoding distinct proteins. Multiple pseudogenes exist for this gene. [provided by RefSeq, Mar 2012]

Uniprot Description

SRI: Calcium-binding protein that modulates excitation- contraction coupling in the heart. Contributes to calcium homeostasis in the heart sarcoplasmic reticulum. Modulates the activity of RYR2 calcium channels.

Protein type: Calcium-binding

Chromosomal Location of Human Ortholog: 7q21.1

Cellular Component: nucleoplasm; endoplasmic reticulum membrane; sarcoplasmic reticulum membrane; smooth endoplasmic reticulum; sarcoplasmic reticulum; mitochondrion; membrane; T-tubule; cytoplasm; nerve terminal; Z disc; cytosol

Molecular Function: protein binding; protease binding; protein heterodimerization activity; calcium channel regulator activity; calcium-dependent cysteine-type endopeptidase activity; calcium ion binding; receptor binding

Biological Process: regulation of action potential; muscle development; cytoplasmic sequestering of transcription factor; negative regulation of heart rate; heart development; regulation of striated muscle contraction; regulation of calcium ion transport; proteolysis; signal transduction; regulation of heart contraction; transport; calcium ion transport; positive regulation of release of sequestered calcium ion into cytosol; intracellular sequestering of iron ion

Research Articles on SRI

Similar Products

Product Notes

The SRI sri (Catalog #AAA958862) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-198. Full Length. The amino acid sequence is listed below: MAYPGHPGAG GGYYPGGYGG APGGPAFPGQ TQDPLYGYFA AVAGQDGQID ADELQRCLTQ SGIAGGYKPF NLETCRLMVS MLDRDMSGTM GFNEFKELWA VLNGWRQHFI SFDTDRSGTV DPQELQKALT TMGFRLSPQA VNSIAKRYST NGKITFDDYI ACCVKLRALT DSFRRRDTAQ QGVVNFPYDD FIQCVMSV . It is sometimes possible for the material contained within the vial of "Sorcin (SRI), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.