Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Probable polyprenol reductase (Srd5a3) Recombinant Protein | Srd5a3 recombinant protein

Recombinant Mesocricetus auratus Probable polyprenol reductase (Srd5a3)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable polyprenol reductase (Srd5a3); Recombinant Mesocricetus auratus Probable polyprenol reductase (Srd5a3); Recombinant Probable polyprenol reductase (Srd5a3); Probable polyprenol reductase EC= 1.3.1.-; 3-oxo-5-alpha-steroid 4-dehydrogenase 3 EC= 1.3.99.5 Steroid 5-alpha-reductase 3; S5AR 3; SR type 3; Srd5a3 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-330
Sequence
MASWVGTELSALNPLRTLWLALAAAFLLALLLQLAPAGLLPNCALFQDLIRYGKTKLSGPRRPAVCRAFDVPKRYFSHFYVVSVLWNGFLLWFLSRSLFLGAPFPNWLRALLRTLGSTQFRALEMESKASQMLVGELALSAFLVLVFLWVHSVRRLFECFYISVFSNAVMHVVQYCFGLVYYVLVGLTVLSQVPMDDKNVYMLGKNLLLPARWFHVLGMMMFLWSSAHQYECHVILSNLRRNKKGAIVHCQHRIPFGDWFEYVSSANYLAELMIYISMAVTFGFHNFTWWLVVAYVFFCQALSAFFNHKFYKSTFVSYPKHRKAFLPFLF
Sequence Length
330
Species
Mesocricetus auratus (Golden hamster)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

UniProt Accession #
Molecular Weight
38,164 Da
UniProt Protein Name
Polyprenol reductase
UniProt Gene Name
Srd5a3
UniProt Synonym Gene Names
S5AR 3; SR type 3
UniProt Entry Name
PORED_MESAU

Uniprot Description

Function: Plays a key role in early steps of protein N-linked glycosylation by being required for the conversion of polyprenol into dolichol. Dolichols are required for the synthesis of dolichol-linked monosaccharides and the oligosaccharide precursor used for N-glycosylation. Acts as a polyprenol reductase that promotes the reduction of the alpha-isoprene unit of polyprenols into dolichols in a NADP-dependent mechanism. Also able to convert testosterone (T) into 5-alpha-dihydrotestosterone (DHT)

By similarity.

Catalytic activity: Ditrans,polycis-dolichol + NADP+ = ditrans,polycis-polyprenol + NADPH.5-alpha-pregnan-3,20-dione + NADP+ = progesterone + NADPH.

Pathway: Protein modification; protein glycosylation.

Subcellular location: Endoplasmic reticulum membrane; Multi-pass membrane protein

By similarity.

Sequence similarities: Belongs to the steroid 5-alpha reductase family. Polyprenol reductase subfamily.

Similar Products

Product Notes

The Probable polyprenol reductase (Srd5a3) srd5a3 (Catalog #AAA1022399) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-330. The amino acid sequence is listed below: MASWVGTELS ALNPLRTLWL ALAAAFLLAL LLQLAPAGLL PNCALFQDLI RYGKTKLSGP RRPAVCRAFD VPKRYFSHFY VVSVLWNGFL LWFLSRSLFL GAPFPNWLRA LLRTLGSTQF RALEMESKAS QMLVGELALS AFLVLVFLWV HSVRRLFECF YISVFSNAVM HVVQYCFGLV YYVLVGLTVL SQVPMDDKNV YMLGKNLLLP ARWFHVLGMM MFLWSSAHQY ECHVILSNLR RNKKGAIVHC QHRIPFGDWF EYVSSANYLA ELMIYISMAV TFGFHNFTWW LVVAYVFFCQ ALSAFFNHKF YKSTFVSYPK HRKAFLPFLF. It is sometimes possible for the material contained within the vial of "Probable polyprenol reductase (Srd5a3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.