Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Probable polyprenol reductase (Srd5a3) Recombinant Protein | Srd5a3 recombinant protein

Recombinant Mouse Probable polyprenol reductase (Srd5a3)

Gene Names
Srd5a3; H5ar; S5AR 3; Srd5a2l; AV364670; AW987574; A430076C09; 1110025P14Rik; D730040M03Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable polyprenol reductase (Srd5a3); Recombinant Mouse Probable polyprenol reductase (Srd5a3); Srd5a3 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-330aa; full length protein
Sequence
MAGWAGFELSALNPLRTLWLALAAAFLFALLLQLAPARLLPSCALFQDLLRYGKTKQSGS RRPAVCRAFDVPKRYFSHFYVISVVWNGSLLWLLSQSLFLGAPFPNWLSALLRTLGATQF QALEMESKASRMPAAELALSAFLVLVFLWVHSLRRLFECFYVSVFSNAAIHVVQYCFGLV YYVLVGLTVLSQVPMDDKNVYVLGKNLLIQARWFHILGMVMFFWSSAHQYKCHVILSNLR RNKKGVVIHCQHRIPFGDWFEYVSSANYLAELMIYISMAVTFGLHNLTWWLVVTYVFSSQ ALSAFFNHKFYRSTFVSYPKHRKAFLPFLF
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Srd5a3 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23,032 Da
NCBI Official Full Name
polyprenol reductase
NCBI Official Synonym Full Names
steroid 5 alpha-reductase 3
NCBI Official Symbol
Srd5a3
NCBI Official Synonym Symbols
H5ar; S5AR 3; Srd5a2l; AV364670; AW987574; A430076C09; 1110025P14Rik; D730040M03Rik
NCBI Protein Information
polyprenol reductase
UniProt Protein Name
Polyprenol reductase
UniProt Gene Name
Srd5a3
UniProt Synonym Gene Names
Srd5a2l; S5AR 3; SR type 3
UniProt Entry Name
PORED_MOUSE

Uniprot Description

SRD5A3: Probable polyprenol reductase. Plays a key role in early steps of protein N-linked glycosylation by being required for the conversion of polyprenol into dolichol. Dolichols are required for the synthesis of dolichol-linked monosaccharides and the oligosaccharide precursor used for N-glycosylation. Probably acts as a polyprenol reductase that promotes the reduction of the alpha-isoprene unit of polyprenols into dolichols in a NADP- dependent mechanism. Also able to convert testosterone (T) into 5- alpha-dihydrotestosterone (DHT). Defects in SRD5A3 are the cause of congenital disorder of glycosylation type 1Q (CDG1Q). It is a multisystem disorder caused by a defect in glycoprotein biosynthesis and characterized by under-glycosylated serum glycoproteins. Congenital disorders of glycosylation result in a wide variety of clinical features, such as defects in the nervous system development, psychomotor retardation, dysmorphic features, hypotonia, coagulation disorders, and immunodeficiency. The broad spectrum of features reflects the critical role of N-glycoproteins during embryonic development, differentiation, and maintenance of cell functions. Defects in SRD5A3 are the cause of Kahrizi syndrome (KHRZ). An autosomal recessive neurodevelopmental disorder characterized by mental retardation, cataracts, coloboma, kyphosis, and coarse facial features. Belongs to the steroid 5-alpha reductase family. Polyprenol reductase subfamily.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Oxidoreductase; Lipid Metabolism - androgen and estrogen; EC 1.3.1.94; EC 1.3.1.22

Cellular Component: cytoplasm; endoplasmic reticulum; integral to membrane; membrane

Molecular Function: 3-oxo-5-alpha-steroid 4-dehydrogenase activity; cholestenone 5-alpha-reductase activity; oxidoreductase activity; oxidoreductase activity, acting on the CH-CH group of donors; oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor

Biological Process: dolichol metabolic process; dolichol-linked oligosaccharide biosynthetic process; lipid metabolic process; polyprenol catabolic process

Research Articles on Srd5a3

Similar Products

Product Notes

The Srd5a3 srd5a3 (Catalog #AAA7030426) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-330aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Srd5a3 srd5a3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAGWAGFELS ALNPLRTLWL ALAAAFLFAL LLQLAPARLL PSCALFQDLL RYGKTKQSGS RRPAVCRAFD VPKRYFSHFY VISVVWNGSL LWLLSQSLFL GAPFPNWLSA LLRTLGATQF QALEMESKAS RMPAAELALS AFLVLVFLWV HSLRRLFECF YVSVFSNAAI HVVQYCFGLV YYVLVGLTVL SQVPMDDKNV YVLGKNLLIQ ARWFHILGMV MFFWSSAHQY KCHVILSNLR RNKKGVVIHC QHRIPFGDWF EYVSSANYLA ELMIYISMAV TFGLHNLTWW LVVTYVFSSQ ALSAFFNHKF YRSTFVSYPK HRKAFLPFLF. It is sometimes possible for the material contained within the vial of "Probable polyprenol reductase (Srd5a3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.