Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

3-oxo-5-alpha-steroid 4-dehydrogenase 1 (Srd5a1) Recombinant Protein | Srd5a1 recombinant protein

Recombinant Mouse 3-oxo-5-alpha-steroid 4-dehydrogenase 1 (Srd5a1)

Gene Names
Srd5a1; S5AR 1; Srd5a-1; 0610031P22Rik; 4930435F02Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
3-oxo-5-alpha-steroid 4-dehydrogenase 1 (Srd5a1); Recombinant Mouse 3-oxo-5-alpha-steroid 4-dehydrogenase 1 (Srd5a1); Srd5a1 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-255aa; full length protein
Sequence
MELDELCLLDALVYLEGFLAFVAFVGLQMVGSSYGRYSSQWSGRRVPARPAWFLQELPSM AWPLYECIRPAAARLGNLPNRVLLAMFLIHYVQRTLVFPVLIRGGKPTLLFTFVLAFLFC TLNGYLQSRYLSQFAVYAEDWVTHPCFLTGFALWLVGMVINIHSDHILRNLRKPGETGYK IPRGGLFEYVSSANYFGELVEWCGFALASWSLQGVVFALFTLCALFTRARQHHQWYLEKF EDYPKTRKILIPFLL
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Srd5a1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29,344 Da
NCBI Official Full Name
3-oxo-5-alpha-steroid 4-dehydrogenase 1
NCBI Official Synonym Full Names
steroid 5 alpha-reductase 1
NCBI Official Symbol
Srd5a1
NCBI Official Synonym Symbols
S5AR 1; Srd5a-1; 0610031P22Rik; 4930435F02Rik
NCBI Protein Information
3-oxo-5-alpha-steroid 4-dehydrogenase 1
UniProt Protein Name
3-oxo-5-alpha-steroid 4-dehydrogenase 1
UniProt Gene Name
Srd5a1
UniProt Synonym Gene Names
S5AR 1
UniProt Entry Name
S5A1_MOUSE

Uniprot Description

SRD5A1: Converts testosterone into 5-alpha-dihydrotestosterone and progesterone or corticosterone into their corresponding 5- alpha-3-oxosteroids. It plays a central role in sexual differentiation and androgen physiology. Belongs to the steroid 5-alpha reductase family.

Protein type: Membrane protein, integral; Lipid Metabolism - androgen and estrogen; Oxidoreductase; EC 1.3.1.22; Membrane protein, multi-pass

Cellular Component: cell soma; cytoplasm; endoplasmic reticulum; integral to membrane; intracellular membrane-bound organelle; membrane; myelin sheath; perinuclear region of cytoplasm

Molecular Function: 3-oxo-5-alpha-steroid 4-dehydrogenase activity; amide binding; cholestenone 5-alpha-reductase activity; oxidoreductase activity; oxidoreductase activity, acting on the CH-CH group of donors

Biological Process: androgen biosynthetic process; androgen metabolic process; cell differentiation; lipid metabolic process; progesterone metabolic process; response to drug; sex differentiation; steroid biosynthetic process; steroid metabolic process

Research Articles on Srd5a1

Similar Products

Product Notes

The Srd5a1 srd5a1 (Catalog #AAA7030416) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-255aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Srd5a1 srd5a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MELDELCLLD ALVYLEGFLA FVAFVGLQMV GSSYGRYSSQ WSGRRVPARP AWFLQELPSM AWPLYECIRP AAARLGNLPN RVLLAMFLIH YVQRTLVFPV LIRGGKPTLL FTFVLAFLFC TLNGYLQSRY LSQFAVYAED WVTHPCFLTG FALWLVGMVI NIHSDHILRN LRKPGETGYK IPRGGLFEYV SSANYFGELV EWCGFALASW SLQGVVFALF TLCALFTRAR QHHQWYLEKF EDYPKTRKIL IPFLL. It is sometimes possible for the material contained within the vial of "3-oxo-5-alpha-steroid 4-dehydrogenase 1 (Srd5a1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.