Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Stage IV sporulation protein FA (spoIVFA) Recombinant Protein | spoIVFA recombinant protein

Recombinant Bacillus subtilis Stage IV sporulation protein FA (spoIVFA)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Stage IV sporulation protein FA (spoIVFA); Recombinant Bacillus subtilis Stage IV sporulation protein FA (spoIVFA); Recombinant Stage IV sporulation protein FA (spoIVFA); Stage IV sporulation protein FA; spoIVFA recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-264
Sequence
MSHRADEIRKRLEKRRKQLSGSKRFSTQTVSEKQKPPSWVMVTDQEKHGTLPVYEDNMPTFNGKHPLVKTDSIILKCLLSACLVLVSAIAYKTNIGPVSQIKPAVAKTFETEFQFASASHWFETKFGNPLAFLAPEHKNKEQQIEVGKDLIAPASGKVQQDFQDNGEGIKVETSSDKIDSVKEGYVVEVSKDSQTGLTVKVQHADNTYSIYGELKDVDVALYDFVDKGKKLGSIKLDDHNKGVYYFAMKDGDKFIDPIQVISFE
Sequence Length
264
Species
Bacillus subtilis (strain 168)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29,607 Da
NCBI Official Full Name
regulator of SpoIVFB (stage IV sporulation)
NCBI Official Symbol
spoIVFA
NCBI Protein Information
regulator of SpoIVFB (stage IV sporulation)
UniProt Protein Name
Stage IV sporulation protein FA
UniProt Gene Name
spoIVFA
UniProt Synonym Gene Names
bofB
UniProt Entry Name
SP4FA_BACSU

Uniprot Description

Function: Implicated in the coupling of mother cell to forespore gene expression. Required for spore formation at 37 degrees Celsius, but not at 30 degrees Celsius. SpoIVFA plays a central role in both maintaining the SpoIVFA/BofA/SpoIVFB complex and anchoring it to the outer forespore membrane. SpoIVFA brings BofA into close proximity to SpoIVFB, allowing BofA to inhibit SpoIVFB. Increased accumulation of SpoIVFA seems to inhibit the activity of SpoIVFB and thus regulates the activation of sigma-K.

Subunit structure: Forms a complex with BofA and SpoIVFB localized in the mother-cell membrane surrounding the forespore. Ref.5

Subcellular location: Forespore outer membrane.

Developmental stage: Transcribed during the stage II, but not required until stage IV of sporulation.

Post-translational modification: May be degraded by FtsH. It is stabilized by an ftsH disruption mutant, and in a probably independent fashion, by overexpression of BofA.

Similar Products

Product Notes

The spoIVFA spoivfa (Catalog #AAA1191091) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-264. The amino acid sequence is listed below: MSHRADEIRK RLEKRRKQLS GSKRFSTQTV SEKQKPPSWV MVTDQEKHGT LPVYEDNMPT FNGKHPLVKT DSIILKCLLS ACLVLVSAIA YKTNIGPVSQ IKPAVAKTFE TEFQFASASH WFETKFGNPL AFLAPEHKNK EQQIEVGKDL IAPASGKVQQ DFQDNGEGIK VETSSDKIDS VKEGYVVEVS KDSQTGLTVK VQHADNTYSI YGELKDVDVA LYDFVDKGKK LGSIKLDDHN KGVYYFAMKD GDKFIDPIQV ISFE. It is sometimes possible for the material contained within the vial of "Stage IV sporulation protein FA (spoIVFA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.