SpoIVB peptidase (spoIVB) Recombinant Protein | spoIVB recombinant protein
Recombinant Bacillus subtilis SpoIVB peptidase (spoIVB)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
SpoIVB peptidase (spoIVB); Recombinant Bacillus subtilis SpoIVB peptidase (spoIVB); spoIVB recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
53-426, Full length protein
Sequence
NAQTSESSEAFTVKKDPHEIKVTGKKSGESELVYDLAGFPIKKTKVHVLPDLKVIPGGQSIGVKLHSVGVLVVGFHQINTSEGKKSPGETAGIEAGDIIIEMNGQKIEKMNDVAPFIQKAGKTGESLDLLIKRDKQKIKTKLIPEKDEGEGKYRIGLYIRDSAAGIGTMTFYEPKTKKYGALGHVISDMDTKKPIVVENGEIVKSTVTSIEKGTGGNPGEKLARFSSERKTIGDINRNSPFGIFGTLHQPIQNNISDQALPVAFSTEVKKGPAEILTVIDDDKVEKFDIEIVSTTPQKFPATKGMVLKITDPRLLKETGGIVQGMSGSPIIQNGKVIGAVTHVFVNDPTSGYGVHIEWMLSEAGIDIYGKEKAS
Sequence Length
374
Species
Bacillus subtilis (strain 168)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46,075 Da
NCBI Official Full Name
peptidase S55
NCBI Official Symbol
spoIVB
NCBI Protein Information
peptidase S55
UniProt Protein Name
SpoIVB peptidase
Protein Family
UniProt Gene Name
spoIVB
Uniprot Description
Plays a central role in the sigma-K checkpoint which coordinates gene expression during the later stages of spore formation. The protease is activated by trans cleavage of the zymogen precursor producing SpoIVB-45 kDa. This undergoes further trimming by cis cleavage to form SpoIVB-43 kDa and SpoIVB-42 kDa. The protease then cleaves the C-terminus of the SpoIVFA metalloprotease activating the latter.
Similar Products
Product Notes
The spoIVB spoivb (Catalog #AAA1132530) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 53-426, Full length protein. The amino acid sequence is listed below: NAQTSESSEA FTVKKDPHEI KVTGKKSGES ELVYDLAGFP IKKTKVHVLP DLKVIPGGQS IGVKLHSVGV LVVGFHQINT SEGKKSPGET AGIEAGDIII EMNGQKIEKM NDVAPFIQKA GKTGESLDLL IKRDKQKIKT KLIPEKDEGE GKYRIGLYIR DSAAGIGTMT FYEPKTKKYG ALGHVISDMD TKKPIVVENG EIVKSTVTSI EKGTGGNPGE KLARFSSERK TIGDINRNSP FGIFGTLHQP IQNNISDQAL PVAFSTEVKK GPAEILTVID DDKVEKFDIE IVSTTPQKFP ATKGMVLKIT DPRLLKETGG IVQGMSGSPI IQNGKVIGAV THVFVNDPTS GYGVHIEWML SEAGIDIYGK EKAS. It is sometimes possible for the material contained within the vial of "SpoIVB peptidase (spoIVB), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
