SDS-PAGE
Spindlin-1 (SPIN1) Recombinant Protein | SPIN1 recombinant protein
Recombinant Human Spindlin-1 (SPIN1)
Gene Names
SPIN1; SPIN
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Spindlin-1 (SPIN1); Recombinant Human Spindlin-1 (SPIN1); Spindlin-1; Ovarian cancer-related protein; SPIN1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-262aa; Full Length
Sequence
MKTPFGKTPGQRSRADAGHAGVSANMMKKRTSHKKHRSSVGPSKPVSQPRRNIVGCRIQHGWKEGNGPVTQWKGTVLDQVPVNPSLYLIKYDGFDCVYGLELNKDERVSALEVLPDRVATSRISDAHLADTMIGKAVEHMFETEDGSKDEWRGMVLARAPVMNTWFYITYEKDPVLYMYQLLDDYKEGDLRIMPDSNDSPPAEREPGEVVDSLVGKQVEYAKEDGSKRTGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKTS
Sequence Length
262
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
Related Product Information for SPIN1 recombinant protein
Chromatin reader that specifically recognizes and binds histone H3 both trimethylated at 'Lys-4' and asymmetrically dimethylated at 'Arg-8' (H3K4me3 and H3R8me2a) and acts as an activator of Wnt signaling pathway downstream of PRMT2. In case of cancer, promotes cell cancer proliferation via activation of the Wnt signaling pathway. Overexpression induces metaphase arrest and chromosomal instability. Localizes to active rDNA loci and promotes the expression of rRNA genes. May play a role in cell-cycle regulation during the transition from gamete to embryo. Involved in oocyte meiotic resumption, a process that takes place before ovulation to resume meiosis of oocytes blocked in prophase I: may act by regulating maternal transcripts to control meiotic resumption.
Product Categories/Family for SPIN1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
56.6 kDa
NCBI Official Full Name
spindlin-1
NCBI Official Synonym Full Names
spindlin 1
NCBI Official Symbol
SPIN1
NCBI Official Synonym Symbols
SPIN
NCBI Protein Information
spindlin-1; spindlin1; ovarian cancer-related protein
UniProt Protein Name
Spindlin-1
Protein Family
UniProt Gene Name
SPIN1
UniProt Synonym Gene Names
OCR; SPIN
UniProt Entry Name
SPIN1_HUMAN
Uniprot Description
SPIN1: May play a role in cell-cycle regulation during the transition from gamete to embryo. Belongs to the SPIN/STSY family.
Protein type: Nucleolus; DNA-binding
Chromosomal Location of Human Ortholog: 9q22.1
Cellular Component: nucleolus; spindle; nucleus
Molecular Function: protein binding; methylated histone residue binding
Biological Process: Wnt receptor signaling pathway; meiotic cell cycle; multicellular organismal development; gamete generation; chromatin modification; positive regulation of Wnt receptor signaling pathway; rRNA transcription
Research Articles on SPIN1
Similar Products
Product Notes
The SPIN1 spin1 (Catalog #AAA1317140) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-262aa; Full Length. The amino acid sequence is listed below: MKTPFGKTPG QRSRADAGHA GVSANMMKKR TSHKKHRSSV GPSKPVSQPR RNIVGCRIQH GWKEGNGPVT QWKGTVLDQV PVNPSLYLIK YDGFDCVYGL ELNKDERVSA LEVLPDRVAT SRISDAHLAD TMIGKAVEHM FETEDGSKDE WRGMVLARAP VMNTWFYITY EKDPVLYMYQ LLDDYKEGDL RIMPDSNDSP PAEREPGEVV DSLVGKQVEY AKEDGSKRTG MVIHQVEAKP SVYFIKFDDD FHIYVYDLVK TS. It is sometimes possible for the material contained within the vial of "Spindlin-1 (SPIN1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
