Putative speedy protein E6 (SPDYE6) Recombinant Protein | SPDYE6 recombinant protein
Recombinant Human Putative speedy protein E6 (SPDYE6)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative speedy protein E6 (SPDYE6); Recombinant Human Putative speedy protein E6 (SPDYE6); SPDYE6 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-402, Full length protein
Sequence
MDRTETRFRKRGQITGKITTSRQPHPQNEQSPQRSTSGYPLQEVVDDEMLGPSAPGVDPSPPCRSLGWKRKREWSDESEEEPEKELAPEPEETWVVEMLCGLKMKLKQQRVSSILPEHHKDFNSQLAPGVDPSPPHRSFCWKRKMEWWDESEESLEEEPRKVLAPEPEEIWVAEMLCGLKMKLKRRRVSLVLPEHHEAFNRLLEDPVIKRFLAWDKDLRVSDKYLLAMVIAYFSRAGFPSWQYQRIHFFLALYLANDMEEDDEDSKQNIFHFLYRKNRSRIPLLRKRWFQLGHSMNPRARKNRSRIPLLRKRRFQLYRSTNPRARKNRSRIPLLRKRRFQLYRSMNSRARKNRSQIVLFQKRRFHFFCSMSCRAWVSPEELEEIQAYDPEHWVWARDRAHLS
Sequence Length
402
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
48,349 Da
NCBI Official Full Name
Putative speedy protein E6
NCBI Official Synonym Full Names
speedy/RINGO cell cycle regulator family member E6
NCBI Official Symbol
SPDYE6
NCBI Protein Information
putative speedy protein E6
UniProt Protein Name
Putative speedy protein E6
Protein Family
UniProt Gene Name
SPDYE6
NCBI Description
This gene encodes a cell cycle regulatory protein which plays an important role in cell cycle progression by binding and activating cyclin-dependent kinases. The encoded protein belongs to a family of cyclin-dependent kinase regulators that contain a speedy box domain which is required for cyclin-dependent kinase activation. [provided by RefSeq, Jul 2017]
Similar Products
Product Notes
The SPDYE6 spdye6 (Catalog #AAA955924) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-402, Full length protein. The amino acid sequence is listed below: MDRTETRFRK RGQITGKITT SRQPHPQNEQ SPQRSTSGYP LQEVVDDEML GPSAPGVDPS PPCRSLGWKR KREWSDESEE EPEKELAPEP EETWVVEMLC GLKMKLKQQR VSSILPEHHK DFNSQLAPGV DPSPPHRSFC WKRKMEWWDE SEESLEEEPR KVLAPEPEEI WVAEMLCGLK MKLKRRRVSL VLPEHHEAFN RLLEDPVIKR FLAWDKDLRV SDKYLLAMVI AYFSRAGFPS WQYQRIHFFL ALYLANDMEE DDEDSKQNIF HFLYRKNRSR IPLLRKRWFQ LGHSMNPRAR KNRSRIPLLR KRRFQLYRST NPRARKNRSR IPLLRKRRFQ LYRSMNSRAR KNRSQIVLFQ KRRFHFFCSM SCRAWVSPEE LEEIQAYDPE HWVWARDRAH LS. It is sometimes possible for the material contained within the vial of "Putative speedy protein E6 (SPDYE6), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
