HLA class II histocompatibility antigen gamma chain (CD74) Active Protein | CD74 active protein

Recombinant Human HLA class II histocompatibility antigen gamma chain (CD74), partial (Active)

Cat. Num. AAA9018398

• Gene Names: CD74; II; DHLAG; HLADG; Ia-GAMMA
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: HLA class II histocompatibility antigen gamma chain (CD74); Recombinant Human HLA class II histocompatibility antigen gamma chain (CD74); partial (Active); (HLA-DR antigens-associated invariant chain)(Ia antigen-associated invariant chain)(Ii)(CD antigen CD74); CD74 active protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 73-232aa, Partial of Isoform 2
• Sequence: QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM

• Species: Homo sapiens (Human)
• Endotoxin: Less than 1.0EU/ug as determined by LAL method.
• Relevance: Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to the endosomal/lysosomal system where the antigen processing and binding of antigenic peptides to MHC class II takes place. Serves as cell surface receptor for the cytokine MIF.[Class-II-associated invariant chain peptide]: Binds to the peptide-binding site of MHC class II alpha/beta heterodimers forming an alpha-beta-CLIP complex, thereby preventing the loading of antigenic peptides to the MHC class II complex until its release by HLA-DM in the endosome.[Isoform p41]: Stabilizes the conformation of mature CTSL by binding to its active site and serving as a chaperone to help maintain a pool of mature enzyme in endocytic compartments and extracellular space of antigen-presenting cells (APCs). Has antiviral activity by stymieing the endosomal entry of Ebola virus and coronaviruses, including SARS-CoV-2. Disrupts cathepsin-mediated Ebola virus glycoprotein processing, which prevents viral fusion and entry. This antiviral activity is specific to p41 isoform.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CD74 at 2ug/mL can bind Anti-CD74 recombinant antibody , the EC50 is 1.317-1.646ng/mL.
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-Page

((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

Activity

Product Categories/Family for CD74 active protein

Immunology

NCBI and Uniprot Product Information

• NCBI GI #: 20178292
• NCBI GeneID: 972
• UniProt Accession #: P04233; Q14597; Q29832; Q5U0J8; Q8SNA0; Q8WLP6; A8K7R1; B4DNE8; D3DQG3; D3DQG4
• Molecular Weight: 296
• NCBI Official Full Name: HLA class II histocompatibility antigen gamma chain
• NCBI Official Synonym Full Names: CD74 molecule, major histocompatibility complex, class II invariant chain
• NCBI Official Symbol: CD74
• NCBI Official Synonym Symbols: II; DHLAG; HLADG; Ia-GAMMA
• NCBI Protein Information: HLA class II histocompatibility antigen gamma chain; p33; HLA-DR-gamma; MHC HLA-DR gamma chain; Ia-associated invariant chain; gamma chain of class II antigens; HLA-DR antigens-associated invariant chain; CD74 antigen (invariant polypeptide of major histo
• UniProt Protein Name: HLA class II histocompatibility antigen gamma chain
• Protein Family: H-2 class II histocompatibility antigen
• UniProt Gene Name: CD74
• UniProt Synonym Gene Names: DHLAG; Ii
• UniProt Entry Name: HG2A_HUMAN

NCBI Description

The protein encoded by this gene associates with class II major histocompatibility complex (MHC) and is an important chaperone that regulates antigen presentation for immune response. It also serves as cell surface receptor for the cytokine macrophage migration inhibitory factor (MIF) which, when bound to the encoded protein, initiates survival pathways and cell proliferation. This protein also interacts with amyloid precursor protein (APP) and suppresses the production of amyloid beta (Abeta). Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Aug 2011]

Uniprot Description

CD74: Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to the endosomal/lysosomal system where the antigen processing and binding of antigenic peptides to MHC class II takes place. Serves as cell surface receptor for the cytokine MIF. A chromosomal aberration involving CD74 is found in a non-small cell lung tumor. Results in the formation of a CD74- ROS1 chimeric protein. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Endoplasmic reticulum; Membrane protein, integral; Receptor, cytokine

Chromosomal Location of Human Ortholog: 5q32

Cellular Component: lysosomal lumen; cell surface; lysosomal membrane; integral to membrane; MHC class II protein complex; Golgi membrane; multivesicular body; membrane; plasma membrane; vacuole; trans-Golgi network membrane; intracellular; external side of plasma membrane

Molecular Function: identical protein binding; hematopoietin/interferon-class (D200-domain) cytokine receptor activity; protein binding; beta-amyloid binding; cytokine binding; MHC class II protein binding, via antigen binding groove; nitric-oxide synthase binding; MHC class II protein binding

Biological Process: activation of MAPK activity; positive regulation of dendritic cell antigen processing and presentation; antigen processing and presentation of exogenous peptide antigen via MHC class II; defense response; prostaglandin biosynthetic process; signal transduction; negative regulation of T cell differentiation; negative regulation of DNA damage response, signal transduction by p53 class mediator; intracellular protein transport; positive regulation of fibroblast proliferation; negative regulation of mature B cell apoptosis; positive regulation of B cell proliferation; protein complex assembly; positive thymic T cell selection; negative regulation of peptide secretion; positive regulation of T-helper 2 type immune response; chaperone cofactor-dependent protein folding; regulation of macrophage activation; T cell selection; negative thymic T cell selection; cell proliferation; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of T cell differentiation; immunoglobulin mediated immune response; positive regulation of cytokine and chemokine mediated signaling pathway; antigen processing and presentation of endogenous antigen; negative regulation of apoptosis