Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Secreted Protein Acidic & Rich in Cysteine Recombinant Protein | SPARC recombinant protein

Recombinant Human Secreted Protein Acidic & Rich in Cysteine

Gene Names
SPARC; ON
Purity
Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Synonyms
Secreted Protein Acidic & Rich in Cysteine; Recombinant Human Secreted Protein Acidic & Rich in Cysteine; SPARC Human; Secreted Protein acidic & Rich in Cysteine Human Recombinant; Osteonectin; ON; Basement-membrane protein 40; BM-40; SPARC; Secreted Protein acidic and Rich in Cysteine; SPARC recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Form/Format
The SPARC (1 mg/ml) was lyophilized after extensive dialyses against 20mM PBS pH-7.4.
Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence
MSYYHHHHHHPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI
Sequence Length
303
Solubility
It is recommended to reconstitute the lyophilized SPARC in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
Preparation and Storage
Lyophilized Osteonectin although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution BM-40 should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Related Product Information for SPARC recombinant protein
Description: Osteonectin Human Recombinant fused with 6X His tag produced in E Coli is a single, non-glycosylated, polypeptide chain containing 295 amino acids and having a molecular mass of 34 kDa.The BM40 is purified by proprietary chromatographic techniques.

Introduction: SPARC, an acronym for œsecreted protein, acidic and rich in cysteine, is also known as osteonectin or BM-40. It is the founding member of a family of secreted matricellular proteins with similar domain structure. The 303 amino acid, 43 kDa protein contains a 17 aa signal sequence, an N-terminal acidic region that binds calcium, a follistatin domain containing Kazal-like sequences, and a C-terminal extracellular calcium (EC) binding domain with two EF-hand motifs. SPARC is produced by fibroblasts, capillary endothelial cells, platelets and macrophages, especially in areas of tissue morphogenesis and remodeling. SPARC shows context-specific effects, but generally inhibits adhesion, spreading and proliferation, and promotes collagen matrix formation. For endothelial cells, SPARC disrupts focal adhesions and binds and sequesters PDGF and VEGF. SPARC is abundantly expressed in bone, where it promotes osteoblast differentiation and inhibits adipogenesis.
Product Categories/Family for SPARC recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34,632 Da
NCBI Official Full Name
SPARC
NCBI Official Synonym Full Names
secreted protein, acidic, cysteine-rich (osteonectin)
NCBI Official Symbol
SPARC
NCBI Official Synonym Symbols
ON
NCBI Protein Information
SPARC; BM-40; basement-membrane protein 40; cysteine-rich protein; osteonectin; secreted protein acidic and rich in cysteine
UniProt Protein Name
SPARC
Protein Family
UniProt Gene Name
SPARC
UniProt Synonym Gene Names
ON; BM-40; ON
UniProt Entry Name
SPRC_HUMAN

NCBI Description

This gene encodes a cysteine-rich acidic matrix-associated protein. The encoded protein is required for the collagen in bone to become calcified but is also involved in extracellular matrix synthesis and promotion of changes to cell shape. The gene product has been associated with tumor suppression but has also been correlated with metastasis based on changes to cell shape which can promote tumor cell invasion. [provided by RefSeq, Dec 2011]

Uniprot Description

SPARC: Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca(2+) with a low affinity and an EF-hand loop that binds a Ca(2+) ion with a high affinity. Belongs to the SPARC family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 5q31.3-q32

Cellular Component: extracellular space; platelet alpha granule membrane; nuclear matrix; cell surface; mitochondrion; cytoplasm; plasma membrane; extracellular region; basement membrane

Molecular Function: collagen binding; protein binding; extracellular matrix binding; calcium ion binding

Biological Process: response to gravity; response to peptide hormone stimulus; receptor-mediated endocytosis; platelet activation; extracellular matrix organization and biogenesis; ossification; response to cAMP; heart development; response to glucocorticoid stimulus; response to lipopolysaccharide; signal transduction; response to L-ascorbic acid; negative regulation of angiogenesis; platelet degranulation; response to cadmium ion; response to ethanol; response to cytokine stimulus; negative regulation of endothelial cell proliferation; response to lead ion; regulation of cell morphogenesis; blood coagulation; response to calcium ion; inner ear development; lung development

Disease: Osteogenesis Imperfecta, Type Xvii

Research Articles on SPARC

Similar Products

Product Notes

The SPARC sparc (Catalog #AAA143252) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MSYYHHHHHH PQQEAL PDETEVVEET VAEVTEVSVG ANPVQVEVGE FDDGAEETEE EVVAENPCQN HHCKHGKVCE LDENNTPMCV CQDPTSCPAP IGEFEKVCSN DNKTFDSSCH FFATKCTLEG TKKGHKLHLD YIGPCKYIPP CLDSELTEFP LRMRDWLKNV LVTLYERDED NNLLTKQKLR VKKIHENEKR LEAGDHPVEL LARDFEKNYN MYIFPVHWQF GQLDQHPIDG YLSHTELAPL RAPLIPMEHC TTRFFETCDL DNDKYIALDE WAGCFGIKQK DIDKDLVI. It is sometimes possible for the material contained within the vial of "Secreted Protein Acidic & Rich in Cysteine, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.