Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Sperm protein associated with the nucleus on the X chromosome D (SPANXD) Recombinant Protein | SPANXD recombinant protein

Recombinant Human Sperm protein associated with the nucleus on the X chromosome D (SPANXD)

Gene Names
SPANXD; CT11.4; SPANXE; SPANX-C; SPANX-D; SPANX-E; dJ171K16.1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Sperm protein associated with the nucleus on the X chromosome D (SPANXD); Recombinant Human Sperm protein associated with the nucleus on the X chromosome D (SPANXD); SPANXD recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-97, Full length protein
Sequence
MDKQSSAGGVKRSVPCDSNEANEMMPETSSGYSDPQPAPKKLKTSESSTILVVRYRRNFKRTSPEELVNDHARKNRINPLQMEEEEFMEIMVEIPAK
Sequence Length
97
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for SPANXD recombinant protein
Temporally regulated transcription and translation of several testis-specific genes is required to initiate the series of molecular and morphological changes in the male germ cell lineage necessary for the formation of mature spermatozoa. This gene is a member of the SPANX family of cancer
testis-associated genes, which are located in a cluster on chromosome X. The SPANX genes encode differentially expressed testis-specific proteins that localize to various subcellular compartments. This particular gene encodes a sperm protein that is associated with the nucleus but, although a role in spermatogenesis is suggested, the specific function of this family member has not yet been determined.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11,029 Da
NCBI Official Full Name
sperm protein associated with the nucleus on the X chromosome D
NCBI Official Synonym Full Names
SPANX family member D
NCBI Official Symbol
SPANXD
NCBI Official Synonym Symbols
CT11.4; SPANXE; SPANX-C; SPANX-D; SPANX-E; dJ171K16.1
NCBI Protein Information
sperm protein associated with the nucleus on the X chromosome D
UniProt Protein Name
Sperm protein associated with the nucleus on the X chromosome D
UniProt Gene Name
SPANXD
UniProt Synonym Gene Names
CT11.4; SPANX-D

NCBI Description

Temporally regulated transcription and translation of several testis-specific genes is required to initiate the series of molecular and morphological changes in the male germ cell lineage necessary for the formation of mature spermatozoa. This gene is a member of the SPANX family of cancer/testis-associated genes, which are located in a cluster on chromosome X. The SPANX genes encode differentially expressed testis-specific proteins that localize to various subcellular compartments. This particular gene encodes a sperm protein that is associated with the nucleus but, although a role in spermatogenesis is suggested, the specific function of this family member has not yet been determined. Polymorphisms in this gene may be associated with prostate cancer susceptibility. [provided by RefSeq, Apr 2014]

Research Articles on SPANXD

Similar Products

Product Notes

The SPANXD spanxd (Catalog #AAA1340804) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-97, Full length protein. The amino acid sequence is listed below: MDKQSSAGGV KRSVPCDSNE ANEMMPETSS GYSDPQPAPK KLKTSESSTI LVVRYRRNFK RTSPEELVND HARKNRINPL QMEEEEFMEI MVEIPAK. It is sometimes possible for the material contained within the vial of "Sperm protein associated with the nucleus on the X chromosome D (SPANXD), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.