Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Sperm-associated antigen 16 protein (SPAG16) Recombinant Protein | SPAG16 recombinant protein

Recombinant Human Sperm-associated antigen 16 protein (SPAG16)

Gene Names
SPAG16; PF20; WDR29
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Sperm-associated antigen 16 protein (SPAG16); Recombinant Human Sperm-associated antigen 16 protein (SPAG16); Sperm-associated antigen 16 protein; Pf20 protein homolog; SPAG16 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-183aa; Full Length of Isoform 4
Sequence
MAAQRGMPSSAVRVLEEALGMGLTAAGDARDTADAVAAEGAYYLEQVTITEASEDDYEYEEIPDDNFSIPEGEEDLAKAIQMAQEQATDTEILERKTVLPSKHAVPEVIEDFLCNFLIKMGMTRTLDCFQSEWYELIQKGVTELRTVGNVPDVYTQIMLLENENKNLKKDLKHYKQAAEYVIF
Sequence Length
631
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Related Product Information for SPAG16 recombinant protein
Necessary for sperm flagellar function. Plays a role in motile ciliogenesis. May help to recruit STK36 to the cilium or apical surface of the cell to initiate subsequent steps of construction of the central pair apparatus of motile cilia
Product Categories/Family for SPAG16 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47.6 kDa
NCBI Official Full Name
sperm-associated antigen 16 protein isoform 2
NCBI Official Synonym Full Names
sperm associated antigen 16
NCBI Official Symbol
SPAG16
NCBI Official Synonym Symbols
PF20; WDR29
NCBI Protein Information
sperm-associated antigen 16 protein; WD repeat domain 29; pf20 protein homolog; sperm-associated WD repeat protein
UniProt Protein Name
Sperm-associated antigen 16 protein
UniProt Gene Name
SPAG16
UniProt Synonym Gene Names
PF20
UniProt Entry Name
SPG16_HUMAN

NCBI Description

Cilia and flagella are comprised of a microtubular backbone, the axoneme, which is organized by the basal body and surrounded by plasma membrane. SPAG16 encodes 2 major proteins that associate with the axoneme of sperm tail and the nucleus of postmeiotic germ cells, respectively (Zhang et al., 2007 [PubMed 17699735]).[supplied by OMIM, Jul 2008]

Uniprot Description

SPAG16: Necessary for sperm flagellar function. Plays a role in motile ciliogenesis. May help to recruit STK36 to the cilium or apical surface of the cell to initiate subsequent steps of construction of the central pair apparatus of motile cilia. 5 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 2q34

Cellular Component: microtubule cytoskeleton; axoneme; nucleus

Molecular Function: protein kinase binding

Biological Process: cilium biogenesis; spermatogenesis

Research Articles on SPAG16

Similar Products

Product Notes

The SPAG16 spag16 (Catalog #AAA1485976) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-183aa; Full Length of Isoform 4. The amino acid sequence is listed below: MAAQRGMPSS AVRVLEEALG MGLTAAGDAR DTADAVAAEG AYYLEQVTIT EASEDDYEYE EIPDDNFSIP EGEEDLAKAI QMAQEQATDT EILERKTVLP SKHAVPEVIE DFLCNFLIKM GMTRTLDCFQ SEWYELIQKG VTELRTVGNV PDVYTQIMLL ENENKNLKKD LKHYKQAAEY VIF. It is sometimes possible for the material contained within the vial of "Sperm-associated antigen 16 protein (SPAG16), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.