Sperm surface protein Sp17 (SPA17) Recombinant Protein | SP17 recombinant protein

Recombinant Human Sperm surface protein Sp17 (SPA17), partial

Cat. Num. AAA963886

• Gene Names: SPA17; CT22; SP17; SP17-1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Sperm surface protein Sp17 (SPA17); Recombinant Human Sperm surface protein Sp17 (SPA17); partial; Cancer/testis antigen 22; CT22; Sp17-1; Sperm autoantigenic protein 17; Sperm protein 17; SP17 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-146. Partial.
• Sequence: MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAKKMKTNSLQNEE
• Sequence Length: 146

• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

Related Product Information for SP17 recombinant protein

Sperm surface zona pellucida binding protein. Helps to bind spermatozoa to the zona pellucida with high affinity. Might function in binding zona pellucida and carbohydrates.

Product Categories/Family for SP17 recombinant protein

Cancer

References

Cloning and sequencing of cDNAs encoding the human sperm protein, Sp17.Lea I.A., Richardson R.T., Widgren E.E., O'Rand M.G.Biochim. Biophys. Acta 1307:263-266(1996) Genomic organization of an intron-containing sperm protein 17 gene (Sp17-1) and an intronless pseudogene (Sp17-2) in humans a new model.Buchli R., De Jong A., Robbins D.L.Biochim. Biophys. Acta 1578:29-42(2002) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004)

NCBI and Uniprot Product Information

• NCBI GI #: 8394343
• NCBI GeneID: 53340
• NCBI Accession #: NP_059121.1
• NCBI GenBank Nucleotide #: NM_017425.3
• UniProt Accession #: Q15506; Q9BXF7; B2R4F2
• Molecular Weight: 43.8 kDa
• NCBI Official Full Name: sperm surface protein Sp17
• NCBI Official Synonym Full Names: sperm autoantigenic protein 17
• NCBI Official Symbol: SPA17
• NCBI Official Synonym Symbols: CT22; SP17; SP17-1
• NCBI Protein Information: sperm surface protein Sp17
• UniProt Protein Name: Sperm surface protein Sp17
• UniProt Gene Name: SPA17
• UniProt Synonym Gene Names: SP17; CT22; Sperm protein 17
• UniProt Entry Name: SP17_HUMAN

NCBI Description

This gene encodes a protein present at the cell surface. The N-terminus has sequence similarity to human cAMP-dependent protein kinase A (PKA) type II alpha regulatory subunit (RIIa) while the C-terminus has an IQ calmodulin-binding motif. The central portion of the protein has carbohydrate binding motifs and likely functions in cell-cell adhesion. The protein was initially characterized by its involvement in the binding of sperm to the zona pellucida of the oocyte. Recent studies indicate that it is also involved in additional cell-cell adhesion functions such as immune cell migration and metastasis. A retrotransposed pseudogene is present on chromosome 10q22.[provided by RefSeq, Jan 2009]

Uniprot Description

SPA17: Sperm surface zona pellucida binding protein. Helps to bind spermatozoa to the zona pellucida with high affinity. Might function in binding zona pellucida and carbohydrates.

Protein type: Cancer Testis Antigen (CTA)

Chromosomal Location of Human Ortholog: 11q24.2

Cellular Component: cytoplasm; external side of plasma membrane

Molecular Function: protein binding

Biological Process: binding of sperm to zona pellucida; single fertilization; spermatogenesis