Sclerostin domain-containing protein 1 (SOSTDC1) Recombinant Protein | SOSTDC1 recombinant protein
Recombinant Chicken Sclerostin domain-containing protein 1 (SOSTDC1)
Gene Names
SOSTDC1; WISE
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Sclerostin domain-containing protein 1 (SOSTDC1); Recombinant Chicken Sclerostin domain-containing protein 1 (SOSTDC1); SOSTDC1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-206, Full length protein
Sequence
AFKNDATEILYSHVVKPAPASPSSNSTLNQARNGGRHYAGTGSDRNNRVQVGCRELRSTKYISDGQCTSINPLKELVCAGECLPLPLLPNWIGGGYGTKYWSRRSSQEWRCVNDKTRTQRIQLQCQDGSIRTYKITVVTACKCKRYTRQHNESSHNFEGTSQAKPVQHHKERKRASKSSKHSTS
Sequence Length
184
Species
Chicken
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for SOSTDC1 recombinant protein
This gene is a member of the sclerostin family and encodes an N-glycosylated, secreted protein with a C-terminal cystine knot-like domain. This protein functions as a bone morphogenetic protein (BMP) antagonist. Specifically, it directly associates with BMPs, prohibiting them from binding their receptors, thereby regulating BMP signaling during cellular proliferation, differentiation, and programmed cell death.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23,144 Da
NCBI Official Full Name
sclerostin domain-containing protein 1
NCBI Official Synonym Full Names
sclerostin domain containing 1
NCBI Official Symbol
SOSTDC1
NCBI Official Synonym Symbols
WISE
NCBI Protein Information
sclerostin domain-containing protein 1
UniProt Protein Name
Sclerostin domain-containing protein 1
Protein Family
UniProt Gene Name
SOSTDC1
UniProt Synonym Gene Names
WISE
Uniprot Description
Can activate or inhibit Wnt signaling in a context-dependent manner. Activates the canonical Wnt pathway whereby acts through Disheveled proteins and beta-catenin. Antagonises Wnt signaling through the canonical pathways presumably by blocking accessibility of certain WNTs to their receptors. Induces posterior neural markers via components of the canonical Wnt pathway.
Research Articles on SOSTDC1
Similar Products
Product Notes
The SOSTDC1 sostdc1 (Catalog #AAA1359047) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-206, Full length protein. The amino acid sequence is listed below: AFKNDATEIL YSHVVKPAPA SPSSNSTLNQ ARNGGRHYAG TGSDRNNRVQ VGCRELRSTK YISDGQCTSI NPLKELVCAG ECLPLPLLPN WIGGGYGTKY WSRRSSQEWR CVNDKTRTQR IQLQCQDGSI RTYKITVVTA CKCKRYTRQH NESSHNFEGT SQAKPVQHHK ERKRASKSSK HSTS. It is sometimes possible for the material contained within the vial of "Sclerostin domain-containing protein 1 (SOSTDC1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
