Solute carrier family 25 member 38 homolog (PGUG_00074) Recombinant Protein | PGUG_00074 recombinant protein
Recombinant Meyerozyma guilliermondii Solute carrier family 25 member 38 homolog (PGUG_00074)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Solute carrier family 25 member 38 homolog (PGUG_00074); Recombinant Meyerozyma guilliermondii Solute carrier family 25 member 38 homolog (PGUG_00074); Recombinant Solute carrier family 25 member 38 homolog (PGUG_00074); Solute carrier family 25 member 38 homolog; PGUG_00074 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-317
Sequence
MASTTPEVKPGTTLHLLAGSSAGLISAFTLQPFDLLKTRLQQQQRANVGYRSSISRELKKLARFKDLWRGALPSTLRTSVGAGLYFTILSQTRTYVAQLRARTDKLPHSQTSVLPKLSALDNLSAGFVVRAVVGFITMPITIIKTRFESNMYNYNSMYEGVEGIYLDGKEKGSLRNFFKGTIATLARDCPYAGLYVLFYESMKNEFVPKTLILFDQQEQLENSTLVNSSAAVVASSLATTITAPFDAIKTRLQLDSHTVGGNSIMSVTKQLLKEDGGVRNLFRGLSLRFGRKGLSAAISWCIYEELLKSGRLQRLLH
Sequence Length
317
Species
Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) (Yeast) (Candida guilliermondii)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
35,092 Da
NCBI Official Full Name
hypothetical protein PGUG_00074
NCBI Official Symbol
PGUG_00074
NCBI Protein Information
hypothetical protein
UniProt Protein Name
Solute carrier family 25 member 38 homolog
UniProt Entry Name
S2538_PICGU
Uniprot Description
Function: Mitochondrial carrier required for the biosynthesis of heme, possibly by facilitating 5-aminolevulinate (ALA) production. May act by importing glycine into mitochondria or by exchanging glycine for ALA across the mitochondrial inner membrane
By similarity.
Subcellular location: Mitochondrion inner membrane; Multi-pass membrane protein
By similarity.
Sequence similarities: Belongs to the mitochondrial carrier family. SLC25A38 subfamily.Contains 3 Solcar repeats.
Similar Products
Product Notes
The PGUG_00074 (Catalog #AAA1139209) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-317. The amino acid sequence is listed below: MASTTPEVKP GTTLHLLAGS SAGLISAFTL QPFDLLKTRL QQQQRANVGY RSSISRELKK LARFKDLWRG ALPSTLRTSV GAGLYFTILS QTRTYVAQLR ARTDKLPHSQ TSVLPKLSAL DNLSAGFVVR AVVGFITMPI TIIKTRFESN MYNYNSMYEG VEGIYLDGKE KGSLRNFFKG TIATLARDCP YAGLYVLFYE SMKNEFVPKT LILFDQQEQL ENSTLVNSSA AVVASSLATT ITAPFDAIKT RLQLDSHTVG GNSIMSVTKQ LLKEDGGVRN LFRGLSLRFG RKGLSAAISW CIYEELLKSG RLQRLLH. It is sometimes possible for the material contained within the vial of "Solute carrier family 25 member 38 homolog (PGUG_00074), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
