Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Snurportin-1 (Snupn) Recombinant Protein | Snupn recombinant protein

Recombinant Rat Snurportin-1 (Snupn)

Gene Names
Snupn; Rnut1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Snurportin-1 (Snupn); Recombinant Rat Snurportin-1 (Snupn); Snupn recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-358, full length protein
Sequence
MEELSQALASSFSVSQELNSTAAPHPRLSQYKSKYSSLEQSERRRQLLELQKSKRLDYVNHARRLAEDDWTGMESGEEEKKKDEEEMDLDPVKKLPKRYANQLMLSEWLIDVPSDLGQEWIVVVCPVGKRALIVASRGSTSAYTKSGYCVNRFSSLLPGGNRRNSTTAKDYTILDCIYSEVNQTYYVLDVMCWRGHPFYDCQTDFRFYWMNSKLPEEEGLGEKTKINPFKFVGLKNFPCTPESLCKVLSMDFPFEVDGLLFYHKQTHYSPGSTPLVGWLRPYMVSDILGVAVPAGPLTTKPEYAGHQLQQIIEHKRSQEDTKEKLTHKASENGHYELEHLSTPKLRSPPHSSESLMDS
Sequence Length
358
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Snupn recombinant protein
The nuclear import of the spliceosomal snRNPs U1, U2, U4 and U5, is dependent on the presence of a complex nuclear localization signal. The latter is composed of the 5 -2,2,7-terminal trimethylguanosine (m3G) cap structure of the U snRNA and the Sm core domain. This protein interacts specifically with m3G-cap and functions as an snRNP-specific nuclear import receptor. Alternatively spliced transcript variants encoding the same protein have been identified for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,964 Da
NCBI Official Full Name
snurportin-1
NCBI Official Synonym Full Names
snurportin 1
NCBI Official Symbol
Snupn
NCBI Official Synonym Symbols
Rnut1
NCBI Protein Information
snurportin-1
UniProt Protein Name
Snurportin-1
UniProt Gene Name
Snupn
UniProt Synonym Gene Names
Rnut1

Uniprot Description

Functions as an U snRNP-specific nuclear import adapter. Involved in the trimethylguanosine (m3G)-cap-dependent nuclear import of U snRNPs. Binds specifically to the terminal m3G-cap U snRNAs.

Similar Products

Product Notes

The Snupn snupn (Catalog #AAA1384555) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-358, full length protein. The amino acid sequence is listed below: MEELSQALAS SFSVSQELNS TAAPHPRLSQ YKSKYSSLEQ SERRRQLLEL QKSKRLDYVN HARRLAEDDW TGMESGEEEK KKDEEEMDLD PVKKLPKRYA NQLMLSEWLI DVPSDLGQEW IVVVCPVGKR ALIVASRGST SAYTKSGYCV NRFSSLLPGG NRRNSTTAKD YTILDCIYSE VNQTYYVLDV MCWRGHPFYD CQTDFRFYWM NSKLPEEEGL GEKTKINPFK FVGLKNFPCT PESLCKVLSM DFPFEVDGLL FYHKQTHYSP GSTPLVGWLR PYMVSDILGV AVPAGPLTTK PEYAGHQLQQ IIEHKRSQED TKEKLTHKAS ENGHYELEHL STPKLRSPPH SSESLMDS. It is sometimes possible for the material contained within the vial of "Snurportin-1 (Snupn), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.