Sensory neuron membrane protein 1 (Snmp1) Recombinant Protein | DgriGH19409 recombinant protein
Recombinant Drosophila grimshawi Sensory neuron membrane protein 1 (Snmp1)
Gene Names
DgriGH19409; dgri_GLEANR_3702; GH19409
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Sensory neuron membrane protein 1 (Snmp1); Recombinant Drosophila grimshawi Sensory neuron membrane protein 1 (Snmp1); Recombinant Sensory neuron membrane protein 1 (Snmp1); Sensory neuron membrane protein 1; DgriGH19409 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
29-460aa; Extracellular domain
Sequence
QILKFMISKQVTLKPGTDVRELWSATPFPLHFYIYVFNVTNPDEVANGGKPRVQEVGPFV FDEWKDKYDLEDDVVEDTVSYNMRNTFFFNEKASSPLTGEEVITLPHPLLQSIGISVQRE RAAMMELIAKALAIILPDAKPFLTAKFMDLFFRGINVDCSSEEFASKALCTVFYTGDVKQ AKQVNQTHFLLSFLGQSNHTDAGRFTVCRGVKNNKKLGMVVKFADEPELDMWLGDECNRF VGTDSTVFAPGLKREDGLWAFTPDLCRSLGAVYKHKSSYHGMPSLRYTLDMGDIRMDEKL HCFCDDPEDLETCPLKGTMNLNRCVGGPLIASMPHFYNGDPKLVQDVDGLNPNQKQHEVF IDFEPISGTPFQAAKRMQFNMDMEPVEGIEPLRHQRKVIMPMFWVEEGVQLNKTYTNMVK HTLFLGLKFNAG
Sequence Length
547
Species
Drosophila grimshawi (Fruit fly) (Idiomyia grimshawi)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61,861 Da
NCBI Official Full Name
GH19409
NCBI Official Symbol
DgriGH19409
NCBI Official Synonym Symbols
dgri_GLEANR_3702; GH19409
NCBI Protein Information
GH19409 gene product from transcript GH19409-RA; DgriGH19409-PA
UniProt Protein Name
Sensory neuron membrane protein 1
UniProt Gene Name
Snmp1
UniProt Entry Name
SNMP1_DROGR
Uniprot Description
Function: Plays an olfactory role that is not restricted to pheromone sensitivity
By similarity. UniProtKB Q9VDD3
Subcellular location: Cell membrane; Multi-pass membrane protein
By similarity UniProtKB O02351.
Sequence similarities: Belongs to the CD36 family.
Similar Products
Product Notes
The DgriGH19409 snmp1 (Catalog #AAA1259923) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 29-460aa; Extracellular domain. The amino acid sequence is listed below: QILKFMISKQ VTLKPGTDVR ELWSATPFPL HFYIYVFNVT NPDEVANGGK PRVQEVGPFV FDEWKDKYDL EDDVVEDTVS YNMRNTFFFN EKASSPLTGE EVITLPHPLL QSIGISVQRE RAAMMELIAK ALAIILPDAK PFLTAKFMDL FFRGINVDCS SEEFASKALC TVFYTGDVKQ AKQVNQTHFL LSFLGQSNHT DAGRFTVCRG VKNNKKLGMV VKFADEPELD MWLGDECNRF VGTDSTVFAP GLKREDGLWA FTPDLCRSLG AVYKHKSSYH GMPSLRYTLD MGDIRMDEKL HCFCDDPEDL ETCPLKGTMN LNRCVGGPLI ASMPHFYNGD PKLVQDVDGL NPNQKQHEVF IDFEPISGTP FQAAKRMQFN MDMEPVEGIE PLRHQRKVIM PMFWVEEGVQ LNKTYTNMVK HTLFLGLKFN AG. It is sometimes possible for the material contained within the vial of "Sensory neuron membrane protein 1 (Snmp1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
