Single-strand selective monofunctional uracil-DNA glycosylase (Smug1) Recombinant Protein | Smug1 recombinant protein

Recombinant Rat Single-strand selective monofunctional uracil-DNA glycosylase (Smug1)

Cat. Num. AAA1483662

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Single-strand selective monofunctional uracil-DNA glycosylase (Smug1); Recombinant Rat Single-strand selective monofunctional uracil-DNA glycosylase (Smug1); Smug1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-278, full length protein
• Sequence: MAVSQTFPPGPAHEPASALMEPCARSLAEGFLEEELRLNAELSQLQFPEPVGVIYNPVDYAWEPHRNYVTRYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVNVVRDWLGIGGSVLSPPQEHPKRPVLGLECPQSEVSGARFWGFFRTLCGQPQVFFRHCFVHNLCPLLFLAPSGRNLTPADLPAKHREQLLSICDAALCRQVQLLGVRLVVGVGRLAEQRARRALAGLTPEVQVEGLLHPSPRSPQANKGWETAARERLQELGLLPLLTDEGSVRPTP
• Sequence Length: 278

• Species: Rat
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 29293823
• NCBI GeneID: 315344
• NCBI Accession #: NP_808795.1
• NCBI GenBank Nucleotide #: NM_177934.3
• UniProt Accession #: Q811Q1
• Molecular Weight: 30,562 Da
• NCBI Official Full Name: single-strand selective monofunctional uracil-DNA glycosylase
• NCBI Official Synonym Full Names: single-strand-selective monofunctional uracil-DNA glycosylase 1
• NCBI Official Symbol: Smug1
• NCBI Protein Information: single-strand selective monofunctional uracil-DNA glycosylase
• UniProt Protein Name: Single-strand selective monofunctional uracil-DNA glycosylase
• Protein Family: Single-strand selective monofunctional uracil DNA glycosylase
• UniProt Gene Name: Smug1

NCBI Description

involved in the repair of 5-formyluracil and other oxidized and deaminated base lesions [RGD, Feb 2006]

Uniprot Description

Recognizes base lesions in the genome and initiates base excision DNA repair. Acts as a monofunctional DNA glycosylase specific for uracil (U) residues in DNA with a preference for single-stranded DNA substrates. The activity is greater toward mismatches (U/G) compared to matches (U/A). Excises uracil (U), 5-formyluracil (fU) and uracil derivatives bearing an oxidized group at C5 [5-hydroxyuracil (hoU) and 5-hydroxymethyluracil (hmU)] in ssDNA and dsDNA, but not analogous cytosine derivatives (5-hydroxycytosine and 5-formylcytosine), nor other oxidized bases. The activity is damage-specific and salt-dependent. The substrate preference is the following: ssDNA > dsDNA (G pair) = dsDNA (A pair) at low salt concentration, and dsDNA (G pair) > dsDNA (A pair) > ssDNA at high salt concentration.