Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Small muscular protein (SMPX) Recombinant Protein | SMPX recombinant protein

Recombinant Human Small muscular protein (SMPX)

Gene Names
SMPX; DFN6; DFNX4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Small muscular protein (SMPX); Recombinant Human Small muscular protein (SMPX); Small muscular protein; Stretch-responsive skeletal muscle protein; SMPX recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-88aa; Full Length
Sequence
MNMSKQPVSNVRAIQANINIPMGAFRPGAGQPPRRKECTPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIKSELKYVPKAEQ
Sequence Length
88
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Related Product Information for SMPX recombinant protein
Plays a role in the regulatory network through which muscle cells coordinate their structural and functional states during growth, adaptation, and repair.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36.6 kDa
NCBI Official Full Name
small muscular protein
NCBI Official Synonym Full Names
small muscle protein, X-linked
NCBI Official Symbol
SMPX
NCBI Official Synonym Symbols
DFN6; DFNX4
NCBI Protein Information
small muscular protein; deafness, X-linked 6, sensorineural; stretch-responsive skeletal muscle protein
UniProt Protein Name
Small muscular protein
Protein Family
UniProt Gene Name
SMPX
UniProt Synonym Gene Names
SRMX
UniProt Entry Name
SMPX_HUMAN

NCBI Description

This gene encodes a small protein that has no known functional domains. Mutations in this gene are a cause of X-linked deafness-4, and the encoded protein may play a role in the maintenance of inner ear cells subjected to mechanical stress. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Dec 2011]

Uniprot Description

SMPX: Plays a role in the regulatory network through which muscle cells coordinate their structural and functional states during growth, adaptation, and repair. Defects in SMPX are the cause of deafness X-linked type 4 (DFNX4). A non-syndromic form of sensorineural, progressive hearing loss with postlingual onset. In affected males, the auditory impairment affects initially high-frequency hearing. It later evolves to become severe to profound and affects all frequencies. Carrier females manifest moderate hearing impairment in the high frequencies. Belongs to the SMPX family.

Protein type: Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: Xp22.1

Cellular Component: muscle tendon junction; costamere; M band; nucleus

Biological Process: striated muscle contraction

Disease: Deafness, X-linked 4

Research Articles on SMPX

Similar Products

Product Notes

The SMPX smpx (Catalog #AAA1391533) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-88aa; Full Length. The amino acid sequence is listed below: MNMSKQPVSN VRAIQANINI PMGAFRPGAG QPPRRKECTP EVEEGVPPTS DEEKKPIPGA KKLPGPAVNL SEIQNIKSEL KYVPKAEQ. It is sometimes possible for the material contained within the vial of "Small muscular protein (SMPX), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.