Mothers against decapentaplegic homolog 3 (Smad3) Recombinant Protein | Smad3 recombinant protein
Recombinant Mouse Mothers against decapentaplegic homolog 3 (Smad3)
Gene Names
Smad3; Madh3; AU022421
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mothers against decapentaplegic homolog 3 (Smad3); Recombinant Mouse Mothers against decapentaplegic homolog 3 (Smad3); Smad3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-425, full length protein
Sequence
SSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS
Sequence Length
424
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Smad3 recombinant protein
This protein belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene mothers against decapentaplegic (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein functions as a transcriptional modulator activated by transforming growth factor-beta and is thought to play a role in the regulation of carcinogenesis.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
48,081 Da
NCBI Official Full Name
mothers against decapentaplegic homolog 3
NCBI Official Synonym Full Names
SMAD family member 3
NCBI Official Symbol
Smad3
NCBI Official Synonym Symbols
Madh3; AU022421
NCBI Protein Information
mothers against decapentaplegic homolog 3
UniProt Protein Name
Mothers against decapentaplegic homolog 3
Protein Family
UniProt Gene Name
Smad3
UniProt Synonym Gene Names
Madh3; MAD homolog 3; Mad3; Mothers against DPP homolog 3; mMad3; SMAD 3; Smad3
Uniprot Description
Receptor-regulated SMAD (R-SMAD) that is an intracellular signal transducer and transcriptional modulator activated by TGF-beta (transforming growth factor) and activin type 1 receptor kinases. Binds the TRE element in the promoter region of many genes that are regulated by TGF-beta and, on formation of the SMAD3/SMAD4 complex, activates transcription. Also can form a SMAD3/SMAD4/JUN/FOS complex at the AP-1/SMAD site to regulate TGF-beta-mediated transcription. Has an inhibitory effect on wound healing probably by modulating both growth and migration of primary keratinocytes and by altering the TGF-mediated chemotaxis of monocytes. This effect on wound healing appears to be hormone-sensitive. Regulator of chondrogenesis and osteogenesis and inhibits early healing of bone fractures. Positively regulates PDPK1 kinase activity by stimulating its dissociation from the 14-3-3 protein YWHAQ which acts as a negative regulator ().
Research Articles on Smad3
Similar Products
Product Notes
The Smad3 smad3 (Catalog #AAA1418092) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-425, full length protein. The amino acid sequence is listed below: SSILPFTPPI VKRLLGWKKG EQNGQEEKWC EKAVKSLVKK LKKTGQLDEL EKAITTQNVN TKCITIPRSL DGRLQVSHRK GLPHVIYCRL WRWPDLHSHH ELRAMELCEF AFNMKKDEVC VNPYHYQRVE TPVLPPVLVP RHTEIPAEFP PLDDYSHSIP ENTNFPAGIE PQSNIPETPP PGYLSEDGET SDHQMNHSMD AGSPNLSPNP MSPAHNNLDL QPVTYCEPAF WCSISYYELN QRVGETFHAS QPSMTVDGFT DPSNSERFCL GLLSNVNRNA AVELTRRHIG RGVRLYYIGG EVFAECLSDS AIFVQSPNCN QRYGWHPATV CKIPPGCNLK IFNNQEFAAL LAQSVNQGFE AVYQLTRMCT IRMSFVKGWG AEYRRQTVTS TPCWIELHLN GPLQWLDKVL TQMGSPSIRC SSVS. It is sometimes possible for the material contained within the vial of "Mothers against decapentaplegic homolog 3 (Smad3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
