Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page

Secreted Ly-6/uPAR-related protein 1 (SLURP1) Recombinant Protein | SLURP1 recombinant protein

Recombinant Human Secreted Ly-6/uPAR-related protein 1 (SLURP1)

Gene Names
SLURP1; ARS; MDM; ANUP; ArsB; LY6LS
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Secreted Ly-6/uPAR-related protein 1 (SLURP1); Recombinant Human Secreted Ly-6/uPAR-related protein 1 (SLURP1); ARS component B; ARS (component B)-81/S; Anti-neoplastic urinary protein; SLURP1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-103aa
Sequence
LKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL
Sequence Length
Full Length of Mature Protein
Organism
Homo sapiens (Human)
Tag Information
NO-tagged
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C.
The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-Page

SDS-Page
Related Product Information for SLURP1 recombinant protein
Has an antitumor activity. Was found to be a marker of late differentiation of the skin. Implicated in maintaining the physiological and structural integrity of the keratinocyte layers of the skin. In vitro down-regulates keratinocyte proliferation; the function may involve the proposed role as modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits alpha-7-dependent nAChR currents in an allosteric manner. In T cells may be involved in regulation of intracellular Ca2+ signaling. Seems to have a immunomodulatory function in the cornea. The function may implicate a possible role as a scavenger receptor for PLAU thereby blocking PLAU-dependent functions of PLAUR such as in cell migration and proliferation
Product Categories/Family for SLURP1 recombinant protein
References
"Partial N-terminal amino acid sequence of the anti-neoplastic urinary protein (ANUP) and the anti-tumour effect of the N-terminal nonapeptide of the unique cytokine present in human granulocytes." Ridge R.J., Sloane N.H.Cytokine 8:1-5 (1996)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
8.9 kDa
NCBI Official Full Name
secreted Ly-6/uPAR-related protein 1
NCBI Official Synonym Full Names
secreted LY6/PLAUR domain containing 1
NCBI Official Symbol
SLURP1
NCBI Official Synonym Symbols
ARS; MDM; ANUP; ArsB; LY6LS
NCBI Protein Information
secreted Ly-6/uPAR-related protein 1
UniProt Protein Name
Secreted Ly-6/uPAR-related protein 1
UniProt Gene Name
SLURP1
UniProt Synonym Gene Names
ARS; SLURP-1; ANUP

NCBI Description

The protein encoded by this gene is a member of the Ly6/uPAR family but lacks a GPI-anchoring signal sequence. It is thought that this secreted protein contains antitumor activity. Mutations in this gene have been associated with Mal de Meleda, a rare autosomal recessive skin disorder. This gene maps to the same chromosomal region as several members of the Ly6/uPAR family of glycoprotein receptors. [provided by RefSeq, Jul 2008]

Uniprot Description

Has an antitumor activity (PubMed:8742060). Was found to be a marker of late differentiation of the skin. Implicated in maintaining the physiological and structural integrity of the keratinocyte layers of the skin (PubMed:14721776, PubMed:17008884). In vitro down-regulates keratinocyte proliferation; the function may involve the proposed role as modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits alpha-7-dependent nAChR currents in an allosteric manner (PubMed:14506129, PubMed:26905431). In T cells may be involved in regulation of intracellular Ca2+ signaling (PubMed:17286989). Seems to have a immunomodulatory function in the cornea (). The function may implicate a possible role as a scavenger receptor for PLAU thereby blocking PLAU-dependent functions of PLAUR such as in cell migration and proliferation (PubMed:25168896).

Research Articles on SLURP1

Similar Products

Product Notes

The SLURP1 slurp1 (Catalog #AAA7110890) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-103aa with tag NO-tagged. The amino acid sequence is listed below: LKCYTCKEPM TSASCRTITR CKPEDTACMT TLVTVEAEYP FNQSPVVTRS CSSSCVATDP DSIGAAHLIF CCFRDLCNSE L. It is sometimes possible for the material contained within the vial of "Secreted Ly-6/uPAR-related protein 1 (SLURP1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.