Antileukoproteinase Recombinant Protein | SLPI recombinant protein

Recombinant Human Antileukoproteinase

Cat. Num. AAA962194

• Gene Names: SLPI; ALP; MPI; ALK1; BLPI; HUSI; WAP4; WFDC4; HUSI-I
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Antileukoproteinase; Recombinant Human Antileukoproteinase; BLPIHUSI-1; Mucus proteinase inhibitor; MPI; Protease inhibitor WAP4; Secretory leukocyte protease inhibitor; Seminal proteinase inhibitor; WAP four-disulfide core domain protein 4; SLPI recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 26-132
• Sequence: SGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA
• Sequence Length: 132

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

Related Product Information for SLPI recombinant protein

Acid-stable proteinase inhibitor with strong affinities for trypsin, chymotrypsin, elastase, and cathepsin G. May prevent elastase-mediated damage to oral and possibly other mucosal tissues.

Product Categories/Family for SLPI recombinant protein

Cardiovascular

References

Molecular cloning and expression of cDNA for human antileukoprotease from cervix uterus.Heinzel R., Appelhans H., Gassen G., Seemueller U., Machleidt W., Fritz H., Steffens G.Eur. J. Biochem. 160:61-67(1986) Isolation and sequence of a human gene encoding a potent inhibitor of leukocyte proteases.Stetler G., Brewer M.T., Thompson R.C.Nucleic Acids Res. 14:7883-7896(1986) Cloning and characterization of SLPI from human intestinal epithelium.Si-Tahar M., Merlin D., Sitaraman S., Madara J.L. Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) The DNA sequence and comparative analysis of human chromosome 20.Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M., Brown A.J., Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P., Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M., Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R., Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M., Ellington A.G., Frankland J.A., Fraser A., French L., Garner P., Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E., Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J., Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D., Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S., Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D., Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A., Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T., Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I., Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H., Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S., Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E., Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A., Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M., Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A., Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S., Rogers J.Nature 414:865-871(2001)

NCBI and Uniprot Product Information

• NCBI GI #: 4507065
• NCBI GeneID: 6590
• NCBI Accession #: NP_003055.1
• NCBI GenBank Nucleotide #: NM_003064.3
• UniProt Accession #: P03973; P07757; B2R5H8
• Molecular Weight: 39.1kD
• NCBI Official Full Name: antileukoproteinase
• NCBI Official Synonym Full Names: secretory leukocyte peptidase inhibitor
• NCBI Official Symbol: SLPI
• NCBI Official Synonym Symbols: ALP; MPI; ALK1; BLPI; HUSI; WAP4; WFDC4; HUSI-I
• NCBI Protein Information: antileukoproteinase
• UniProt Protein Name: Antileukoproteinase
• Protein Family: Antileukoproteinase
• UniProt Gene Name: SLPI
• UniProt Synonym Gene Names: WAP4; WFDC4; MPI
• UniProt Entry Name: SLPI_HUMAN

NCBI Description

This gene encodes a secreted inhibitor which protects epithelial tissues from serine proteases. It is found in various secretions including seminal plasma, cervical mucus, and bronchial secretions, and has affinity for trypsin, leukocyte elastase, and cathepsin G. Its inhibitory effect contributes to the immune response by protecting epithelial surfaces from attack by endogenous proteolytic enzymes. This antimicrobial protein has antibacterial, antifungal and antiviral activity. [provided by RefSeq, Nov 2014]

Uniprot Description

SLPI: Acid-stable proteinase inhibitor with strong affinities for trypsin, chymotrypsin, elastase, and cathepsin G. May prevent elastase-mediated damage to oral and possibly other mucosal tissues.

Protein type: Inhibitor; Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 20q12

Cellular Component: extracellular matrix; extracellular space

Molecular Function: endopeptidase inhibitor activity; enzyme binding; protein binding; serine-type endopeptidase inhibitor activity

Biological Process: antibacterial humoral response; immune response; innate immune response; negative regulation of protein binding; negative regulation of viral genome replication; response to lipopolysaccharide