Fork head domain transcription factor slp1 (slp1) Recombinant Protein | slp1 recombinant protein
Recombinant Drosophila melanogaster Fork head domain transcription factor slp1 (slp1)
Gene Names
slp1; CG16738; DmelCG16738; Dmslp1; FD6; FoxG; l(2)05965; sko1; slp; Slp; SLP; slp-1; Slp-1; slp-2; Slp1; SLP1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Fork head domain transcription factor slp1 (slp1); Recombinant Drosophila melanogaster Fork head domain transcription factor slp1 (slp1); slp1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-322, Full length protein
Sequence
MVKSEMEFKSNFSIDAILAKKPINTATQPIKTEPVHHHHQYVHPYSNSDGELSASEDFDSPSRTSTPMSSAAESLSSQNNDKLDVEFDDELEDQLDEDQESEDGNPSKKQKMTAGSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRKNPGASRTRLAAYRQAIFSPMMAASPYGAPAPSYGYPAVPFAAAAAAALYQRMNPAAYQAAYQQMQYQQAPQAHHHQAPHPAQMQGYPPQLNAELFQRMQFFGKFPSS
Sequence Length
322
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
36,202 Da
NCBI Official Full Name
sloppy paired 1
NCBI Official Synonym Full Names
sloppy paired 1
NCBI Official Symbol
slp1
NCBI Official Synonym Symbols
CG16738; DmelCG16738; Dmslp1; FD6; FoxG; l(2)05965; sko1; slp; Slp; SLP; slp-1; Slp-1; slp-2; Slp1; SLP1
NCBI Protein Information
CG16738 gene product from transcript CG16738-RA
UniProt Protein Name
Fork head domain transcription factor slp1
Protein Family
UniProt Gene Name
slp1
UniProt Synonym Gene Names
FD6
Uniprot Description
Transcription factor involved in segmentation. Required for the formation of the mandibular lobe. Different levels of slp activity seem to be required in different segments.
Research Articles on slp1
Similar Products
Product Notes
The slp1 slp1 (Catalog #AAA1114813) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-322, Full length protein. The amino acid sequence is listed below: MVKSEMEFKS NFSIDAILAK KPINTATQPI KTEPVHHHHQ YVHPYSNSDG ELSASEDFDS PSRTSTPMSS AAESLSSQNN DKLDVEFDDE LEDQLDEDQE SEDGNPSKKQ KMTAGSDTKK PPYSYNALIM MAIQDSPEQR LTLNGIYQYL INRFPYFKAN KRGWQNSIRH NLSLNKCFTK IPRSYDDPGK GNYWILDPSA EEVFIGETTG KLRRKNPGAS RTRLAAYRQA IFSPMMAASP YGAPAPSYGY PAVPFAAAAA AALYQRMNPA AYQAAYQQMQ YQQAPQAHHH QAPHPAQMQG YPPQLNAELF QRMQFFGKFP SS. It is sometimes possible for the material contained within the vial of "Fork head domain transcription factor slp1 (slp1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
