Cystine/glutamate transporter (SLC7A11) Recombinant Protein | SLC7A11 recombinant protein

Recombinant Human Cystine/glutamate transporter (SLC7A11)

Cat. Num. AAA9018457

• Gene Names: SLC7A11; xCT; CCBR1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Cystine/glutamate transporter (SLC7A11); Recombinant Human Cystine/glutamate transporter (SLC7A11); Amino acid transport system xc- (Calcium channel blocker resistance protein CCBR1)(Solute carrier family 7 member 11)(xCT); SLC7A11 recombinant protein

• Host: Cell Free Expression
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 1-501aa, Full Length
• Sequence: MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSIIIGTIIGAGIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGPLPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLLSNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIMSEKITRTLQIILEVVPEEDKL

• Species: Homo sapiens (Human)
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for SLC7A11 recombinant protein

This is a recombinant transmembrane protein expressed in a cell-free expression system.

Product Categories/Family for SLC7A11 recombinant protein

Cell Biology

NCBI and Uniprot Product Information

• NCBI GI #: 7657683
• NCBI GeneID: 23657
• NCBI Accession #: NP_055146.1
• NCBI GenBank Nucleotide #: NM_014331.3
• UniProt Accession #: Q9UPY5; A8K2U4
• Molecular Weight: 55,423 Da
• NCBI Official Full Name: cystine/glutamate transporter
• NCBI Official Synonym Full Names: solute carrier family 7 (anionic amino acid transporter light chain, xc- system), member 11
• NCBI Official Symbol: SLC7A11
• NCBI Official Synonym Symbols: xCT; CCBR1
• NCBI Protein Information: cystine/glutamate transporter; amino acid transport system xc-; calcium channel blocker resistance protein CCBR1; solute carrier family 7 member 11; solute carrier family 7, (cationic amino acid transporter, y+ system) member 11
• UniProt Protein Name: Cystine/glutamate transporter
• Protein Family: Cystine/glutamate transporter
• UniProt Gene Name: SLC7A11
• UniProt Entry Name: XCT_HUMAN

NCBI Description

This gene encodes a member of a heteromeric, sodium-independent, anionic amino acid transport system that is highly specific for cysteine and glutamate. In this system, designated Xc(-), the anionic form of cysteine is transported in exchange for glutamate. This protein has been identified as the predominant mediator of Kaposi sarcoma-associated herpesvirus fusion and entry permissiveness into cells. Also, increased expression of this gene in primary gliomas (compared to normal brain tissue) was associated with increased glutamate secretion via the XCT channels, resulting in neuronal cell death. [provided by RefSeq, Sep 2011]

Uniprot Description

SLC7A11: Sodium-independent, high-affinity exchange of anionic amino acids with high specificity for anionic form of cystine and glutamate. Belongs to the amino acid-polyamine-organocation (APC) superfamily. L-type amino acid transporter (LAT) (TC 2.A.3.8) family.

Protein type: Membrane protein, multi-pass; Transporter; Transporter, SLC family; Membrane protein, integral

Chromosomal Location of Human Ortholog: 4q28.3

Cellular Component: cell surface; cytoskeleton; rough endoplasmic reticulum; plasma membrane; integral to membrane

Molecular Function: protein binding; cystine:glutamate antiporter activity

Biological Process: response to nicotine; amino acid transport; response to toxin; ion transport; brain development; response to oxidative stress; blood coagulation; transmembrane transport; leukocyte migration