Zinc transporter SLC39A7 (Slc39a7) Recombinant Protein | Slc39a7 recombinant protein
Recombinant Mouse Zinc transporter SLC39A7 (Slc39a7)
Gene Names
Slc39a7; Ke4; Ke-4; Zip7; Ring5; H-2Ke4; H2-Ke4; AA408174; AI117660; AL024048
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Zinc transporter SLC39A7 (Slc39a7); Recombinant Mouse Zinc transporter SLC39A7 (Slc39a7); Slc39a7 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-476aa; full length protein
Sequence
MTMGLRAPHWVAVGLLTWAALGLLVAGHEGHGDLHKDVEEDFHGHSHGHSHEDFHHGHSH GHSHEDFHHGHGHTHESIWHGHAHSHDHGHSREELHHGHSHGHSHDSLHHGGHGHAHREH SHGTSREAGAPGIKHHLDTVTLWAYALGATVLISAAPFFVLFLIPVESNSPRHRSLLQIL LSFASGGLLGDAFLHLIPHALEPHSHHAPEQPGHGHSHSGQGPILSVGLWVLSGIVAFLV VEKFVRHVKGGHGHSHGHGDRHAHGDSHTHGDRHECSSKEKPSTEEEKEVGGLRKRRGGN TGPRDGPVKPQSPEEEKAGSDLRVSGYLNLAADLAHNFTDGLAIGASFRGGRGLGILTTM TVLLHEVPHEVGDFAILVQSGCSKKQAMRLQLVTAIGALAGTACALLTEGGAVDSDVAGG AGPGWVLPFTAGGFIYVATVSVLPELLREASPLQSLLEVLGLLGGVAMMVLIAHLE
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Slc39a7 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
50,657 Da
NCBI Official Full Name
zinc transporter SLC39A7
NCBI Official Synonym Full Names
solute carrier family 39 (zinc transporter), member 7
NCBI Official Symbol
Slc39a7
NCBI Official Synonym Symbols
Ke4; Ke-4; Zip7; Ring5; H-2Ke4; H2-Ke4; AA408174; AI117660; AL024048
NCBI Protein Information
zinc transporter SLC39A7
UniProt Protein Name
Zinc transporter SLC39A7
Protein Family
UniProt Gene Name
Slc39a7
UniProt Synonym Gene Names
H2-Ke4; Hke4; ZIP7
UniProt Entry Name
S39A7_MOUSE
Uniprot Description
SLC39A7: transports zinc from the Golgi and endoplasmic reticulum to the cytoplasm. This transport may be important for activation of tyrosine kinases, some of which could be involved in cancer progression. Therefore, modulation of the encoded protein could be useful as a therapeutic agent against cancer. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Nov 2011]
Protein type: Membrane protein, multi-pass; Membrane protein, integral; Transporter; Transporter, SLC family
Cellular Component: endoplasmic reticulum; Golgi apparatus; integral to membrane; membrane; nucleoplasm
Molecular Function: metal ion transmembrane transporter activity; protein binding; zinc ion transmembrane transporter activity
Biological Process: cellular zinc ion homeostasis; ion transport; metal ion transport; transmembrane transport; transport; zinc ion transport
Research Articles on Slc39a7
Similar Products
Product Notes
The Slc39a7 slc39a7 (Catalog #AAA7030120) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-476aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Slc39a7 slc39a7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MTMGLRAPHW VAVGLLTWAA LGLLVAGHEG HGDLHKDVEE DFHGHSHGHS HEDFHHGHSH GHSHEDFHHG HGHTHESIWH GHAHSHDHGH SREELHHGHS HGHSHDSLHH GGHGHAHREH SHGTSREAGA PGIKHHLDTV TLWAYALGAT VLISAAPFFV LFLIPVESNS PRHRSLLQIL LSFASGGLLG DAFLHLIPHA LEPHSHHAPE QPGHGHSHSG QGPILSVGLW VLSGIVAFLV VEKFVRHVKG GHGHSHGHGD RHAHGDSHTH GDRHECSSKE KPSTEEEKEV GGLRKRRGGN TGPRDGPVKP QSPEEEKAGS DLRVSGYLNL AADLAHNFTD GLAIGASFRG GRGLGILTTM TVLLHEVPHE VGDFAILVQS GCSKKQAMRL QLVTAIGALA GTACALLTEG GAVDSDVAGG AGPGWVLPFT AGGFIYVATV SVLPELLREA SPLQSLLEVL GLLGGVAMMV LIAHLE. It is sometimes possible for the material contained within the vial of "Zinc transporter SLC39A7 (Slc39a7), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
