Probable low affinity copper uptake protein 2 (SLC31A2) Recombinant Protein | SLC31A2 recombinant protein
Recombinant Human Probable low affinity copper uptake protein 2 (SLC31A2)
Gene Names
SLC31A2; CTR2; COPT2; hCTR2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable low affinity copper uptake protein 2 (SLC31A2); Recombinant Human Probable low affinity copper uptake protein 2 (SLC31A2); Recombinant Probable low affinity copper uptake protein 2 (SLC31A2); Probable low affinity copper uptake protein 2; Copper transporter 2; hCTR2 Solute carrier family 31 member 2; SLC31A2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-143
Sequence
MAMHFIFSDTAVLLFDFWSVHSPAGMALSVLVLLLLAVLYEGIKVGKAKLLNQVLVNLPTSISQQTIAETDGDSAGSDSFPVGRTHHRWYLCHFGQSLIHVIQVVIGYFIMLAVMSYNTWIFLGVVLGSAVGYYLAYPLLSTA
Sequence Length
143
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15,681 Da
NCBI Official Full Name
probable low affinity copper uptake protein 2
NCBI Official Synonym Full Names
solute carrier family 31 (copper transporters), member 2
NCBI Official Symbol
SLC31A2
NCBI Official Synonym Symbols
CTR2; COPT2; hCTR2
NCBI Protein Information
probable low affinity copper uptake protein 2; copper transporter 2; solute carrier family 31 member 2
UniProt Protein Name
Probable low affinity copper uptake protein 2
Protein Family
UniProt Gene Name
SLC31A2
UniProt Synonym Gene Names
COPT2; CTR2; hCTR2
UniProt Entry Name
COPT2_HUMAN
Uniprot Description
SLC31A2: Involved in low-affinity copper uptake (Potential). Belongs to the copper transporter (Ctr) (TC 1.A.56) family. SLC31A subfamily.
Protein type: Transporter; Membrane protein, multi-pass; Membrane protein, integral; Transporter, SLC family
Chromosomal Location of Human Ortholog: 9q32
Cellular Component: recycling endosome; integral to plasma membrane; late endosome
Molecular Function: copper ion transmembrane transporter activity
Biological Process: cellular copper ion homeostasis; copper ion transport
Research Articles on SLC31A2
Similar Products
Product Notes
The SLC31A2 slc31a2 (Catalog #AAA1103670) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-143. The amino acid sequence is listed below: MAMHFIFSDT AVLLFDFWSV HSPAGMALSV LVLLLLAVLY EGIKVGKAKL LNQVLVNLPT SISQQTIAET DGDSAGSDSF PVGRTHHRWY LCHFGQSLIH VIQVVIGYFI MLAVMSYNTW IFLGVVLGSA VGYYLAYPLL STA. It is sometimes possible for the material contained within the vial of "Probable low affinity copper uptake protein 2 (SLC31A2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
