Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-Slc31a2 Polyclonal Antibody)

Rabbit anti-Mouse Slc31a2 Polyclonal Antibody | anti-Slc31a2 antibody

Slc31a2 Polyclonal Antibody

Gene Names
SLC31A2; CTR2; COPT2; hCTR2
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
Slc31a2; Polyclonal Antibody; Slc31a2 Polyclonal Antibody; SLC31A2; COPT2; CTR2; hCTR2; AI604396; solute carrier family 31 member 2; anti-Slc31a2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
1.43 mg/ml (varies by lot)
Sequence Length
143
Applicable Applications for anti-Slc31a2 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of mouse Slc31a2 (NP_001277447.1).
Immunogen Sequence
MHFIFSDEAVLLFDFWRVHSPTGMALSVLVVLLLAVLYEGIKVGKAKLLHKTLESLPATNSQQFILGPDQDSTGSRSTSDNRTRLRWFLCYFGQSLVHVI
Positive Samples
Mouse Pancreas
Cellular Location
Membrane, Multi-Pass Membrane Protein
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-Slc31a2 Polyclonal Antibody)

Western Blot (WB) (Western blot-Slc31a2 Polyclonal Antibody)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 15kDa
Observed: 16kDa
NCBI Official Full Name
probable low affinity copper uptake protein 2
NCBI Official Synonym Full Names
solute carrier family 31 member 2
NCBI Official Symbol
SLC31A2
NCBI Official Synonym Symbols
CTR2; COPT2; hCTR2
NCBI Protein Information
probable low affinity copper uptake protein 2
UniProt Protein Name
Probable low affinity copper uptake protein 2
UniProt Gene Name
SLC31A2
UniProt Synonym Gene Names
COPT2; CTR2; hCTR2

Uniprot Description

SLC31A2: Involved in low-affinity copper uptake (Potential). Belongs to the copper transporter (Ctr) (TC 1.A.56) family. SLC31A subfamily.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Transporter; Transporter, SLC family

Chromosomal Location of Human Ortholog: 9q32

Cellular Component: integral component of plasma membrane; late endosome; recycling endosome

Molecular Function: copper ion transmembrane transporter activity

Biological Process: cellular copper ion homeostasis; copper ion transport

Research Articles on Slc31a2

Similar Products

Product Notes

The Slc31a2 slc31a2 (Catalog #AAA9140811) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Slc31a2 Polyclonal Antibody reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Slc31a2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the Slc31a2 slc31a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Slc31a2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.