High affinity copper uptake protein 1 (Slc31a1) Recombinant Protein | Slc31a1 recombinant protein
Recombinant Mouse High affinity copper uptake protein 1 (Slc31a1)
Gene Names
Slc31a1; Ctr1; AI787263; AU016967; 4930445G01Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
High affinity copper uptake protein 1 (Slc31a1); Recombinant Mouse High affinity copper uptake protein 1 (Slc31a1); Slc31a1 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-196aa; full length protein
Sequence
MNHMGMNHMEMHHHMGMNHTDDNITMPPHHHPTTSASHSHGGGDSMMMMPMTFYFDFKNV NLLFSGLVINTPGEMAGAFVAVFLLAMFYEGLKIAREGLLRKSQVSIRYNSMPVPGPNGT ILMETHKTVGQQMLSFPHLLQTVLHIIQVVISYFLMLIFMTYNGYLCIAVAAGAGTGYFL FSWKKAVVVDITEHCH
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Slc31a1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
21,961 Da
NCBI Official Full Name
high affinity copper uptake protein 1
NCBI Official Synonym Full Names
solute carrier family 31, member 1
NCBI Official Symbol
Slc31a1
NCBI Official Synonym Symbols
Ctr1; AI787263; AU016967; 4930445G01Rik
NCBI Protein Information
high affinity copper uptake protein 1
UniProt Protein Name
High affinity copper uptake protein 1
Protein Family
UniProt Gene Name
Slc31a1
UniProt Synonym Gene Names
CTR1
UniProt Entry Name
COPT1_MOUSE
Uniprot Description
SLC31A1: High-affinity, saturable copper transporter involved in dietary copper uptake. Belongs to the copper transporter (Ctr) (TC 1.A.56) family. SLC31A subfamily.
Protein type: Membrane protein, multi-pass; Membrane protein, integral; Transporter, SLC family; Transporter
Cellular Component: cell soma; cytoplasm; integral to membrane; late endosome; membrane; plasma membrane; recycling endosome
Molecular Function: copper ion transmembrane transporter activity; copper uptake transmembrane transporter activity; protein binding
Biological Process: cellular copper ion homeostasis; copper ion import; copper ion transport; ion transport; multidrug transport; transport
Research Articles on Slc31a1
Similar Products
Product Notes
The Slc31a1 slc31a1 (Catalog #AAA7030087) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-196aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Slc31a1 slc31a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MNHMGMNHME MHHHMGMNHT DDNITMPPHH HPTTSASHSH GGGDSMMMMP MTFYFDFKNV NLLFSGLVIN TPGEMAGAFV AVFLLAMFYE GLKIAREGLL RKSQVSIRYN SMPVPGPNGT ILMETHKTVG QQMLSFPHLL QTVLHIIQVV ISYFLMLIFM TYNGYLCIAV AAGAGTGYFL FSWKKAVVVD ITEHCH. It is sometimes possible for the material contained within the vial of "High affinity copper uptake protein 1 (Slc31a1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
