Solute carrier family 2, facilitated glucose transporter member 4 (SLC2A4) Recombinant Protein | SLC2A4 recombinant protein

Recombinant Human Solute carrier family 2, facilitated glucose transporter member 4 (SLC2A4), partial

Cat. Num. AAA951139

• Gene Names: SLC2A4; GLUT4
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Solute carrier family 2; facilitated glucose transporter member 4 (SLC2A4); Recombinant Human Solute carrier family 2; partial; SLC2A4 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 467-509. Fragment at the C-terminal.
• Sequence: RVPETRGRTFDQISAAFHRTPSLLEQEVKPSTELEYLGPDEND
• Sequence Length: 509

• Species: Homo sapiens (Human)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 4507011
• NCBI GeneID: 6517
• NCBI Accession #: NP_001033.1
• NCBI GenBank Nucleotide #: NM_001042.2
• UniProt Accession #: P14672; Q05BQ3; Q14CX2
• Molecular Weight: 43,760 Da
• NCBI Official Full Name: solute carrier family 2, facilitated glucose transporter member 4
• NCBI Official Synonym Full Names: solute carrier family 2 member 4
• NCBI Official Symbol: SLC2A4
• NCBI Official Synonym Symbols: GLUT4
• NCBI Protein Information: solute carrier family 2, facilitated glucose transporter member 4
• UniProt Protein Name: Solute carrier family 2, facilitated glucose transporter member 4
• Protein Family: Solute carrier family
• UniProt Gene Name: SLC2A4
• UniProt Synonym Gene Names: GLUT4; GLUT-4

NCBI Description

This gene is a member of the solute carrier family 2 (facilitated glucose transporter) family and encodes a protein that functions as an insulin-regulated facilitative glucose transporter. In the absence of insulin, this integral membrane protein is sequestered within the cells of muscle and adipose tissue. Within minutes of insulin stimulation, the protein moves to the cell surface and begins to transport glucose across the cell membrane. Mutations in this gene have been associated with noninsulin-dependent diabetes mellitus (NIDDM). [provided by RefSeq, Jul 2008]

Uniprot Description

Insulin-regulated facilitative glucose transporter.MiscellaneousInsulin-stimulated phosphorylation of TBC1D4 is required for GLUT4 translocation.