Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Solute carrier family 2, facilitated glucose transporter member 2 (SLC2A2) Recombinant Protein | SLC2A2 recombinant protein

Recombinant Pig Solute carrier family 2, facilitated glucose transporter member 2 (SLC2A2)

Gene Names
SLC2A2; GLUT2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Solute carrier family 2; facilitated glucose transporter member 2 (SLC2A2); Recombinant Pig Solute carrier family 2; Recombinant Solute carrier family 2; facilitated glucose transporter member 2; Glucose transporter type 2; liver; GLUT-2; SLC2A2 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-120
Sequence
VCAIFMSVGLVLLDKLPWMSYVSMTAIFLFVSFFEIGPGPIPWFMVAEFFSQGPRPAALAMAAFSNWTRNFIIALCFQYIADFCGPYVFFLFAGVVLVFTLFTFFKVPETKGKSFEEIAA
Sequence Length
120
Species
Sus scrofa (Pig)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
13,503 Da
NCBI Official Full Name
Solute carrier family 2, facilitated glucose transporter member 2
NCBI Official Symbol
SLC2A2
NCBI Official Synonym Symbols
GLUT2
NCBI Protein Information
solute carrier family 2, facilitated glucose transporter member 2; GLUT-2; glucose transporter type 2, liver
UniProt Protein Name
Solute carrier family 2, facilitated glucose transporter member 2
Protein Family
UniProt Gene Name
SLC2A2
UniProt Synonym Gene Names
GLUT2; GLUT-2
UniProt Entry Name
GTR2_PIG

Uniprot Description

Function: Facilitative glucose transporter. This isoform likely mediates the bidirectional transfer of glucose across the plasma membrane of hepatocytes and is responsible for uptake of glucose by the beta cells; may comprise part of the glucose-sensing mechanism of the beta cell. May also participate with the Na+/glucose cotransporter in the transcellular transport of glucose in the small intestine and kidney

By similarity.

Subcellular location: Membrane; Multi-pass membrane protein.

Post-translational modification: N-glycosylated; required for stability and retention at the cell surface of pancreatic beta cells

By similarity.

Sequence similarities: Belongs to the major facilitator superfamily. Sugar transporter (TC 2.A.1.1) family. Glucose transporter subfamily. [View classification]

Similar Products

Product Notes

The SLC2A2 slc2a2 (Catalog #AAA1077825) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-120. The amino acid sequence is listed below: VCAIFMSVGL VLLDKLPWMS YVSMTAIFLF VSFFEIGPGP IPWFMVAEFF SQGPRPAALA MAAFSNWTRN FIIALCFQYI ADFCGPYVFF LFAGVVLVFT LFTFFKVPET KGKSFEEIAA. It is sometimes possible for the material contained within the vial of "Solute carrier family 2, facilitated glucose transporter member 2 (SLC2A2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.