Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Bile acyl-CoA synthetase (Slc27a5) Recombinant Protein | Slc27a5 recombinant protein

Recombinant Mouse Bile acyl-CoA synthetase (Slc27a5)

Gene Names
Slc27a5; FATP5; FACVL3; VLCSH2; Vlacsr; VLCS-H2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Bile acyl-CoA synthetase (Slc27a5); Recombinant Mouse Bile acyl-CoA synthetase (Slc27a5); Slc27a5 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-689aa; full length protein
Sequence
MGIWKKLTLLLLLLLLVGLGQPPWPAAMALALRWFLGDPTCLVLLGLALLGRPWISSWMP HWLSLVGAALTLFLLPLQPPPGLRWLHKDVAFTFKMLFYGLKFRRRLNKHPPETFVDALE RQALAWPDRVALVCTGSEGSSITNSQLDARSCQAAWVLKAKLKDAVIQNTRDAAAILVLP SKTISALSVFLGLAKLGCPVAWINPHSRGMPLLHSVRSSGASVLIVDPDLQENLEEVLPK LLAENIHCFYLGHSSPTPGVEALGASLDAAPSDPVPASLRATIKWKSPAIFIFTSGTTGL PKPAILSHERVIQVSNVLSFCGCRADDVVYDVLPLYHTIGLVLGFLGCLQVGATCVLAPK FSASRFWAECRQHGVTVILYVGEILRYLCNVPEQPEDKIHTVRLAMGNGLRANVWKNFQQ RFGPIRIWEFYGSTEGNVGLMNYVGHCGAVGRTSCILRMLTPFELVQFDIETAEPLRDKQ GFCIPVEPGKPGLLLTKVRKNQPFLGYRGSQAESNRKLVANVRRVGDLYFNTGDVLTLDQ EGFFYFQDRLGDTFRWKGENVSTGEVECVLSSLDFLEEVNVYGVPVPGCEGKVGMAAVKL APGKTFDGQKLYQHVRSWLPAYATPHFIRIQDSLEITNTYKLVKSRLVREGFDVGIIADP LYILDNKAQTFRSLMPDVYQAVCEGTWNL
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Slc27a5 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
76,203 Da
NCBI Official Full Name
bile acyl-CoA synthetase
NCBI Official Synonym Full Names
solute carrier family 27 (fatty acid transporter), member 5
NCBI Official Symbol
Slc27a5
NCBI Official Synonym Symbols
FATP5; FACVL3; VLCSH2; Vlacsr; VLCS-H2
NCBI Protein Information
bile acyl-CoA synthetase
UniProt Protein Name
Bile acyl-CoA synthetase
Protein Family
UniProt Gene Name
Slc27a5
UniProt Synonym Gene Names
Acsb; Acsvl6; Fatp5; Vlacsr; BACS; BA-CoA ligase; BAL; FATP-5; VLACS-related; VLACSR
UniProt Entry Name
S27A5_MOUSE

Uniprot Description

SLC27A5: Acyl-CoA synthetase involved in bile acid metabolism. Proposed to catalyze the first step in the conjugation of C24 bile acids (choloneates) to glycine and taurine before excretion into bile canaliculi by activating them to their CoA thioesters. Seems to activate secondary bile acids entering the liver from the enterohepatic circulation. In vitro, also activates 3-alpha,7- alpha,12-alpha-trihydroxy-5-beta-cholestanate (THCA), the C27 precursor of cholic acid deriving from the de novo synthesis from cholesterol. Belongs to the ATP-dependent AMP-binding enzyme family.

Protein type: EC 6.2.1.7; Membrane protein, integral; Membrane protein, multi-pass; Ligase; Lipid Metabolism - primary bile acid biosynthesis; Endoplasmic reticulum

Cellular Component: basal plasma membrane; endoplasmic reticulum; integral to endoplasmic reticulum membrane; integral to membrane; intracellular membrane-bound organelle; membrane; protein complex

Molecular Function: ATP binding; catalytic activity; cholate-CoA ligase activity; fatty acid transporter activity; ligase activity; long-chain-fatty-acid-CoA ligase activity; nucleotide binding; protein complex binding; very-long-chain-fatty-acid-CoA ligase activity

Biological Process: bile acid biosynthetic process; bile acid metabolic process; fatty acid metabolic process; fatty acid transport; ketone body biosynthetic process; lipid metabolic process; long-chain fatty acid metabolic process; metabolic process; plasma membrane long-chain fatty acid transport; triacylglycerol mobilization; very-long-chain fatty acid metabolic process

Research Articles on Slc27a5

Similar Products

Product Notes

The Slc27a5 slc27a5 (Catalog #AAA7030038) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-689aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Slc27a5 slc27a5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGIWKKLTLL LLLLLLVGLG QPPWPAAMAL ALRWFLGDPT CLVLLGLALL GRPWISSWMP HWLSLVGAAL TLFLLPLQPP PGLRWLHKDV AFTFKMLFYG LKFRRRLNKH PPETFVDALE RQALAWPDRV ALVCTGSEGS SITNSQLDAR SCQAAWVLKA KLKDAVIQNT RDAAAILVLP SKTISALSVF LGLAKLGCPV AWINPHSRGM PLLHSVRSSG ASVLIVDPDL QENLEEVLPK LLAENIHCFY LGHSSPTPGV EALGASLDAA PSDPVPASLR ATIKWKSPAI FIFTSGTTGL PKPAILSHER VIQVSNVLSF CGCRADDVVY DVLPLYHTIG LVLGFLGCLQ VGATCVLAPK FSASRFWAEC RQHGVTVILY VGEILRYLCN VPEQPEDKIH TVRLAMGNGL RANVWKNFQQ RFGPIRIWEF YGSTEGNVGL MNYVGHCGAV GRTSCILRML TPFELVQFDI ETAEPLRDKQ GFCIPVEPGK PGLLLTKVRK NQPFLGYRGS QAESNRKLVA NVRRVGDLYF NTGDVLTLDQ EGFFYFQDRL GDTFRWKGEN VSTGEVECVL SSLDFLEEVN VYGVPVPGCE GKVGMAAVKL APGKTFDGQK LYQHVRSWLP AYATPHFIRI QDSLEITNTY KLVKSRLVRE GFDVGIIADP LYILDNKAQT FRSLMPDVYQ AVCEGTWNL. It is sometimes possible for the material contained within the vial of "Bile acyl-CoA synthetase (Slc27a5), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.