Sulfate anion transporter 1 (Slc26a1) Recombinant Protein | Slc26a1 recombinant protein
Recombinant Rat Sulfate anion transporter 1 (Slc26a1), partial
Gene Names
Slc26a1; sat-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Sulfate anion transporter 1 (Slc26a1); Recombinant Rat Sulfate anion transporter 1 (Slc26a1); partial; Slc26a1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-703
Sequence
MDASPEPPQKGGTLVLVRRQPPVSQGLLETLKARLKKSCTCSMPCAQALVQGLFPVIRWLPQYRLKEYLAGDVMSGLVIGIILVPQAIAYSLLAGLQPIYSLYTSFFANLIYFLMGTSRHVNVGIFSLLCLMVGQVVDRELQLAGFDPSQDSLGPGNNDSTLNNTATLTVGLQDCGRDCHAIRIATALTLMAGLYQVLMGILRLGFVSTYLSQPLLDGFAMGASVTILTSQAKHLLGVRIPRHQGLGMVIHTWLSLLQNVGQANLCDVVTSAVCLAVLLTAKELSDRYRHYLKVPVPTELLVIVVATIASHFGQLHTRFGSSVAGNIPTGFVAPQIPDPKIMWSVALDAMSLALVGSAFSISLAEMFARSHGYSVSANQELLAVGCCNVLPAFFHCFATSAALSKTLVKIATGCQTQLSSVVSAAVVLLVLLVLAPLFHDLQRCVLACIIVVSLRGALRKVKDLPQLWRLSPADALVWVATAATCVLVSIEAGLLAGVFFSLLSLAGRTQRPRAALLARIGDSTFYEDAAEFEGLLPPPEVRVFRFTGPLYYANKDFFLRSLYSLTGLDAGYSATRKDRGTEVGVSNRSLVDRKDLGSVSSGDGLVVPLAFGFHTVVIDCAPLLFLDVAGMATLKDLRKNYRALDITLLLACCSPSVRDTLRKGGFLGEDQGTAEELLFPSVHSAVETACARREELMAADSAL
Sequence Length
703
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
75,447 Da
NCBI Official Full Name
Sulfate anion transporter 1
NCBI Official Synonym Full Names
solute carrier family 26 member 1
NCBI Official Symbol
Slc26a1
NCBI Official Synonym Symbols
sat-1
NCBI Protein Information
sulfate anion transporter 1
UniProt Protein Name
Sulfate anion transporter 1
Protein Family
UniProt Gene Name
Slc26a1
UniProt Synonym Gene Names
Sat1; SAT-1
NCBI Description
sulfate transporter [RGD, Feb 2006]
Uniprot Description
Mediates sulfate transport with high affinity (PubMed:8300633). Mediates oxalate transport (PubMed:8300633). Mediates bicarbonate transport (). Does not accept succinate as cosubstrate (PubMed:8300633).
Research Articles on Slc26a1
Similar Products
Product Notes
The Slc26a1 slc26a1 (Catalog #AAA961937) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-703. The amino acid sequence is listed below: MDASPEPPQK GGTLVLVRRQ PPVSQGLLET LKARLKKSCT CSMPCAQALV QGLFPVIRWL PQYRLKEYLA GDVMSGLVIG IILVPQAIAY SLLAGLQPIY SLYTSFFANL IYFLMGTSRH VNVGIFSLLC LMVGQVVDRE LQLAGFDPSQ DSLGPGNNDS TLNNTATLTV GLQDCGRDCH AIRIATALTL MAGLYQVLMG ILRLGFVSTY LSQPLLDGFA MGASVTILTS QAKHLLGVRI PRHQGLGMVI HTWLSLLQNV GQANLCDVVT SAVCLAVLLT AKELSDRYRH YLKVPVPTEL LVIVVATIAS HFGQLHTRFG SSVAGNIPTG FVAPQIPDPK IMWSVALDAM SLALVGSAFS ISLAEMFARS HGYSVSANQE LLAVGCCNVL PAFFHCFATS AALSKTLVKI ATGCQTQLSS VVSAAVVLLV LLVLAPLFHD LQRCVLACII VVSLRGALRK VKDLPQLWRL SPADALVWVA TAATCVLVSI EAGLLAGVFF SLLSLAGRTQ RPRAALLARI GDSTFYEDAA EFEGLLPPPE VRVFRFTGPL YYANKDFFLR SLYSLTGLDA GYSATRKDRG TEVGVSNRSL VDRKDLGSVS SGDGLVVPLA FGFHTVVIDC APLLFLDVAG MATLKDLRKN YRALDITLLL ACCSPSVRDT LRKGGFLGED QGTAEELLFP SVHSAVETAC ARREELMAAD SAL. It is sometimes possible for the material contained within the vial of "Sulfate anion transporter 1 (Slc26a1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
