ADP/ATP translocase 1 (SLC25A4) Recombinant Protein | SLC25A4 recombinant protein
Recombinant Rabbit ADP/ATP translocase 1 (SLC25A4)
Gene Names
SLC25A4; SLC25A5
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ADP/ATP translocase 1 (SLC25A4); Recombinant Rabbit ADP/ATP translocase 1 (SLC25A4); Recombinant ADP/ATP translocase 1 (SLC25A4); ADP/ATP translocase 1; 30 kDa calsequestrin-binding protein; 30 kDa CSQ-binding protein ADP; ATP carrier protein 1 Adenine nucleotide translocator 1; ANT 1 Solute carrier family 25 member 4; SLC25A4 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-298
Sequence
SDQALSFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGAAQREFSGLGNCLTKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQTVTAVAGLVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWKKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV
Sequence Length
298
Species
Oryctolagus cuniculus (Rabbit)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32,901 Da
NCBI Official Full Name
ADP/ATP translocase 1
NCBI Official Symbol
SLC25A4
NCBI Official Synonym Symbols
SLC25A5
NCBI Protein Information
ADP/ATP translocase 1; ANT 1; ADP,ATP carrier protein 1; 30 kDa CSQ-binding protein; CSQ-binding 30 kDa protein; adenine nucleotide translocator 1; solute carrier family 25 member 4; 30 kDa calsequestrin-binding protein; solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5
UniProt Protein Name
ADP/ATP translocase 1
Protein Family
UniProt Gene Name
SLC25A4
UniProt Synonym Gene Names
ANT1; 30 kDa CSQ-binding protein; ANT 1
UniProt Entry Name
ADT1_RABIT
Uniprot Description
Function: Catalyzes the exchange of cytoplasmic ADP with mitochondrial ATP across the mitochondrial inner membrane
By similarity.
Subunit structure: Homodimer
By similarity.
Subcellular location: Mitochondrion inner membrane; Multi-pass membrane protein
By similarity.
Miscellaneous: The transmembrane helices are not perpendicular to the plane of the membrane, but cross the membrane at an angle. Odd-numbered transmembrane helices exhibit a sharp kink, due to the presence of a conserved proline residue
By similarity.
Sequence similarities: Belongs to the mitochondrial carrier family.Contains 3 Solcar repeats.
Similar Products
Product Notes
The SLC25A4 slc25a4 (Catalog #AAA1094883) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-298. The amino acid sequence is listed below: SDQALSFLKD FLAGGVAAAV SKTAVAPIER VKLLLQVQHA SKQISAEKQY KGIIDCVVRI PKEQGFLSFW RGNLANVIRY FPTQALNFAF KDKYKQIFLG GVDRHKQFWR YFAGNLASGG AAGATSLCFV YPLDFARTRL AADVGKGAAQ REFSGLGNCL TKIFKSDGLR GLYQGFNVSV QGIIIYRAAY FGVYDTAKGM LPDPKNVHII VSWMIAQTVT AVAGLVSYPF DTVRRRMMMQ SGRKGADIMY TGTVDCWKKI AKDEGAKAFF KGAWSNVLRG MGGAFVLVLY DEIKKYV. It is sometimes possible for the material contained within the vial of "ADP/ATP translocase 1 (SLC25A4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
