Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ADP/ATP translocase 1 (Slc25a4) Recombinant Protein | Slc25a4 recombinant protein

Recombinant Rat ADP/ATP translocase 1 (Slc25a4)

Gene Names
Slc25a4; Ant1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ADP/ATP translocase 1 (Slc25a4); Recombinant Rat ADP/ATP translocase 1 (Slc25a4); Slc25a4 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
2-298. Full Length of Mature Protein
Sequence
GDQALSFLKDFLAGGIAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGSSQREFNGLGDCLTKIFKSDGLKGLYQGFSVSVQGIIIYRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIAKDEGRKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Rat
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Slc25a4 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32,989 Da
NCBI Official Full Name
ADP/ATP translocase 1
NCBI Official Synonym Full Names
solute carrier family 25 member 4
NCBI Official Symbol
Slc25a4
NCBI Official Synonym Symbols
Ant1
NCBI Protein Information
ADP/ATP translocase 1
UniProt Protein Name
ADP/ATP translocase 1
Protein Family
UniProt Gene Name
Slc25a4
UniProt Synonym Gene Names
Ant1; ANT 1
UniProt Entry Name
ADT1_RAT

NCBI Description

catalyzes the exchange of ADP and ATP across the mitochondrial inner membrane [RGD, Feb 2006]

Uniprot Description

SLC25A4: Catalyzes the exchange of cytoplasmic ADP with mitochondrial ATP across the mitochondrial inner membrane. Defects in SLC25A4 are a cause of progressive external ophthalmoplegia with mitochondrial DNA deletions autosomal dominant type 2 (PEOA2). Progressive external ophthalmoplegia is characterized by progressive weakness of ocular muscles and levator muscle of the upper eyelid. In a minority of cases, it is associated with skeletal myopathy, which predominantly involves axial or proximal muscles and which causes abnormal fatigability and even permanent muscle weakness. Ragged- red fibers and atrophy are found on muscle biopsy. A large proportion of chronic ophthalmoplegias are associated with other symptoms, leading to a multisystemic pattern of this disease. Additional symptoms are variable, and may include cataracts, hearing loss, sensory axonal neuropathy, ataxia, depression, hypogonadism, and parkinsonism. Belongs to the mitochondrial carrier family.

Protein type: Membrane protein, multi-pass; Transporter, SLC family; Mitochondrial; Membrane protein, integral; Transporter

Cellular Component: integral to membrane; mitochondrial inner membrane; mitochondrial outer membrane; mitochondrion; myelin sheath; nucleus

Molecular Function: enzyme binding; protein binding; structural constituent of ribosome; transporter activity

Biological Process: aging; apoptotic mitochondrial changes; heart development; liver development; translation; transmembrane transport

Research Articles on Slc25a4

Similar Products

Product Notes

The Slc25a4 slc25a4 (Catalog #AAA7029980) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-298. Full Length of Mature Protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Slc25a4 slc25a4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GDQALSFLKD FLAGGIAAAV SKTAVAPIER VKLLLQVQHA SKQISAEKQY KGIIDCVVRI PKEQGFLSFW RGNLANVIRY FPTQALNFAF KDKYKQIFLG GVDRHKQFWR YFAGNLASGG AAGATSLCFV YPLDFARTRL AADVGKGSSQ REFNGLGDCL TKIFKSDGLK GLYQGFSVSV QGIIIYRAAY FGVYDTAKGM LPDPKNVHII VSWMIAQSVT AVAGLVSYPF DTVRRRMMMQ SGRKGADIMY TGTVDCWRKI AKDEGRKAFF KGAWSNVLRG MGGAFVLVLY DEIKKYV . It is sometimes possible for the material contained within the vial of "ADP/ATP translocase 1 (Slc25a4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.