Calcium-binding mitochondrial carrier protein SCaMC-2 (Slc25a25) Recombinant Protein | Slc25a25 recombinant protein
Recombinant Mouse Calcium-binding mitochondrial carrier protein SCaMC-2 (Slc25a25)
Gene Names
Slc25a25; MCSC; mKIAA1896; 1110030N17Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Calcium-binding mitochondrial carrier protein SCaMC-2 (Slc25a25); Recombinant Mouse Calcium-binding mitochondrial carrier protein SCaMC-2 (Slc25a25); Recombinant Calcium-binding mitochondrial carrier protein SCaMC-2 (Slc25a25); Calcium-binding mitochondrial carrier protein SCaMC-2; Small calcium-binding mitochondrial carrier protein 2 Solute carrier family 25 member 25; Slc25a25 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-469
Sequence
MLCLCLYVPIAGAAQTEFQYFESKGLPAELKSIFKLSVFIPSQEFSTYRQWKQKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLRLVFKSLDKKNDGRIDAQEIMQSLRDLGVKISEQQAEKILKSMDKNGTMTIDWNEWRDYHLLHPVENIPEIILYWKHSTIFDVGENLTVPDEFTVEERQTGMWWRHLVAGGGAGAVSRTCTAPLDRLKVLMQVHASRSNNMCIVGGFTQMIREGGAKSLWRGNGINVLKIAPESAIKFMAYEQMKRLVGSDQETLRIHERLVAGSLAGAIAQSSIYPMEVLKTRMALRKTGQYSGMLDCARRILAKEGVAAFYKGYIPNMLGIIPYAGIDLAVYETLKNTWLQRYAVNSADPGVFVLLACGTISSTCGQLASYPLALVRTRMQAQASIEGAPEVTMSSLFKQILRTEGAFGLYRGLAPNFMKVIPAVSISYVVYENLKITLGVQSR
Sequence Length
469
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
52,621 Da
NCBI Official Full Name
calcium-binding mitochondrial carrier protein SCaMC-2 isoform 2
NCBI Official Synonym Full Names
solute carrier family 25 (mitochondrial carrier, phosphate carrier), member 25
NCBI Official Symbol
Slc25a25
NCBI Official Synonym Symbols
MCSC; mKIAA1896; 1110030N17Rik
NCBI Protein Information
calcium-binding mitochondrial carrier protein SCaMC-2; solute carrier family 25 member 25; mitochondrial Ca2+-dependent solute carrier; small calcium-binding mitochondrial carrier protein 2
UniProt Protein Name
Calcium-binding mitochondrial carrier protein SCaMC-2
Protein Family
UniProt Gene Name
Slc25a25
UniProt Synonym Gene Names
Kiaa1896; Scamc2
UniProt Entry Name
SCMC2_MOUSE
Uniprot Description
SLC25A25: Calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. May act as a ATP-Mg/Pi exchanger that mediates the transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into or from the mitochondria. Belongs to the mitochondrial carrier family. 6 isoforms of the human protein are produced by alternative splicing.
Protein type: Transporter; Transporter, SLC family; Membrane protein, integral; Mitochondrial; Membrane protein, multi-pass
Cellular Component: membrane; intracellular membrane-bound organelle; mitochondrion; mitochondrial inner membrane; integral to membrane
Molecular Function: metal ion binding; calcium ion binding
Biological Process: ATP metabolic process; response to food; response to dietary excess; camera-type eye development; transport; multicellular organism growth; cellular respiration; response to activity; transmembrane transport
Research Articles on Slc25a25
Similar Products
Product Notes
The Slc25a25 slc25a25 (Catalog #AAA963761) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-469. The amino acid sequence is listed below: MLCLCLYVPI AGAAQTEFQY FESKGLPAEL KSIFKLSVFI PSQEFSTYRQ WKQKIVQAGD KDLDGQLDFE EFVHYLQDHE KKLRLVFKSL DKKNDGRIDA QEIMQSLRDL GVKISEQQAE KILKSMDKNG TMTIDWNEWR DYHLLHPVEN IPEIILYWKH STIFDVGENL TVPDEFTVEE RQTGMWWRHL VAGGGAGAVS RTCTAPLDRL KVLMQVHASR SNNMCIVGGF TQMIREGGAK SLWRGNGINV LKIAPESAIK FMAYEQMKRL VGSDQETLRI HERLVAGSLA GAIAQSSIYP MEVLKTRMAL RKTGQYSGML DCARRILAKE GVAAFYKGYI PNMLGIIPYA GIDLAVYETL KNTWLQRYAV NSADPGVFVL LACGTISSTC GQLASYPLAL VRTRMQAQAS IEGAPEVTMS SLFKQILRTE GAFGLYRGLA PNFMKVIPAV SISYVVYENL KITLGVQSR. It is sometimes possible for the material contained within the vial of "Calcium-binding mitochondrial carrier protein SCaMC-2 (Slc25a25), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
