Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Calcium-binding mitochondrial carrier protein SCaMC-2 (SLC25A25) Recombinant Protein | SLC25A25 recombinant protein

Recombinant Human Calcium-binding mitochondrial carrier protein SCaMC-2 (SLC25A25)

Gene Names
SLC25A25; MCSC; PCSCL; SCAMC-2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Calcium-binding mitochondrial carrier protein SCaMC-2 (SLC25A25); Recombinant Human Calcium-binding mitochondrial carrier protein SCaMC-2 (SLC25A25); SLC25A25 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-469aa; full length protein
Sequence
MLCLCLYVPVIGEAQTEFQYFESKGLPAELKSIFKLSVFIPSQEFSTYRQWKQKIVQAGD KDLDGQLDFEEFVHYLQDHEKKLRLVFKSLDKKNDGRIDAQEIMQSLRDLGVKISEQQAE KILKSMDKNGTMTIDWNEWRDYHLLHPVENIPEIILYWKHSTIFDVGENLTVPDEFTVEE RQTGMWWRHLVAGGGAGAVSRTCTAPLDRLKVLMQVHASRSNNMGIVGGFTQMIREGGAR SLWRGNGINVLKIAPESAIKFMAYEQIKRLVGSDQETLRIHERLVAGSLAGAIAQSSIYP MEVLKTRMALRKTGQYSGMLDCARRILAREGVAAFYKGYVPNMLGIIPYAGIDLAVYETL KNAWLQHYAVNSADPGVFVLLACGTMSSTCGQLASYPLALVRTRMQAQASIEGAPEVTMS SLFKHILRTEGAFGLYRGLAPNFMKVIPAVSISYVVYENLKITLGVQSR
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for SLC25A25 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
40,589 Da
NCBI Official Full Name
calcium-binding mitochondrial carrier protein SCaMC-2 isoform b
NCBI Official Synonym Full Names
solute carrier family 25 member 25
NCBI Official Symbol
SLC25A25
NCBI Official Synonym Symbols
MCSC; PCSCL; SCAMC-2
NCBI Protein Information
calcium-binding mitochondrial carrier protein SCaMC-2
UniProt Protein Name
Calcium-binding mitochondrial carrier protein SCaMC-2
UniProt Gene Name
SLC25A25
UniProt Synonym Gene Names
APC3; KIAA1896; MCSC3; SCAMC2
UniProt Entry Name
SCMC2_HUMAN

NCBI Description

The protein encoded by this gene belongs to the family of calcium-binding mitochondrial carriers, with a characteristic mitochondrial carrier domain at the C-terminus. These proteins are found in the inner membranes of mitochondria, and function as transport proteins. They shuttle metabolites, nucleotides and cofactors through the mitochondrial membrane and thereby connect and/or regulate cytoplasm and matrix functions. This protein may function as an ATP-Mg/Pi carrier that mediates the transport of Mg-ATP in exchange for phosphate, and likely responsible for the net uptake or efflux of adenine nucleotides into or from the mitochondria. Alternatively spliced transcript variants encoding different isoforms with a common C-terminus but variable N-termini have been described for this gene. [provided by RefSeq, Jul 2012]

Uniprot Description

Calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. May act as a ATP-Mg/Pi exchanger that mediates the transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into or from the mitochondria.

Research Articles on SLC25A25

Similar Products

Product Notes

The SLC25A25 slc25a25 (Catalog #AAA7029902) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-469aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the SLC25A25 slc25a25 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MLCLCLYVPV IGEAQTEFQY FESKGLPAEL KSIFKLSVFI PSQEFSTYRQ WKQKIVQAGD KDLDGQLDFE EFVHYLQDHE KKLRLVFKSL DKKNDGRIDA QEIMQSLRDL GVKISEQQAE KILKSMDKNG TMTIDWNEWR DYHLLHPVEN IPEIILYWKH STIFDVGENL TVPDEFTVEE RQTGMWWRHL VAGGGAGAVS RTCTAPLDRL KVLMQVHASR SNNMGIVGGF TQMIREGGAR SLWRGNGINV LKIAPESAIK FMAYEQIKRL VGSDQETLRI HERLVAGSLA GAIAQSSIYP MEVLKTRMAL RKTGQYSGML DCARRILARE GVAAFYKGYV PNMLGIIPYA GIDLAVYETL KNAWLQHYAV NSADPGVFVL LACGTMSSTC GQLASYPLAL VRTRMQAQAS IEGAPEVTMS SLFKHILRTE GAFGLYRGLA PNFMKVIPAV SISYVVYENL KITLGVQSR. It is sometimes possible for the material contained within the vial of "Calcium-binding mitochondrial carrier protein SCaMC-2 (SLC25A25), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.